Author: remy.maucherat(a)jboss.com
Date: 2012-09-21 10:14:07 -0400 (Fri, 21 Sep 2012)
New Revision: 2083
Removed:
trunk/src/main/java/org/apache/jasper/compiler/Localizer.java
trunk/src/main/java/org/apache/jasper/resources/LocalStrings.properties
trunk/src/main/java/org/apache/jasper/resources/LocalStrings_es.properties
trunk/src/main/java/org/apache/jasper/resources/LocalStrings_fr.properties
trunk/src/main/java/org/apache/jasper/resources/LocalStrings_ja.properties
Modified:
trunk/src/main/java/org/apache/jasper/EmbeddedServletOptions.java
trunk/src/main/java/org/apache/jasper/JspCompilationContext.java
trunk/src/main/java/org/apache/jasper/compiler/AttributeParser.java
trunk/src/main/java/org/apache/jasper/compiler/BeanRepository.java
trunk/src/main/java/org/apache/jasper/compiler/Compiler.java
trunk/src/main/java/org/apache/jasper/compiler/DefaultErrorHandler.java
trunk/src/main/java/org/apache/jasper/compiler/ErrorDispatcher.java
trunk/src/main/java/org/apache/jasper/compiler/Generator.java
trunk/src/main/java/org/apache/jasper/compiler/ImplicitTagLibraryInfo.java
trunk/src/main/java/org/apache/jasper/compiler/JavacErrorDetail.java
trunk/src/main/java/org/apache/jasper/compiler/JspConfig.java
trunk/src/main/java/org/apache/jasper/compiler/JspDocumentParser.java
trunk/src/main/java/org/apache/jasper/compiler/JspReader.java
trunk/src/main/java/org/apache/jasper/compiler/JspRuntimeContext.java
trunk/src/main/java/org/apache/jasper/compiler/JspUtil.java
trunk/src/main/java/org/apache/jasper/compiler/PageInfo.java
trunk/src/main/java/org/apache/jasper/compiler/Parser.java
trunk/src/main/java/org/apache/jasper/compiler/ParserController.java
trunk/src/main/java/org/apache/jasper/compiler/ScriptingVariabler.java
trunk/src/main/java/org/apache/jasper/compiler/TagFileProcessor.java
trunk/src/main/java/org/apache/jasper/compiler/TagLibraryInfoImpl.java
trunk/src/main/java/org/apache/jasper/compiler/TagPluginManager.java
trunk/src/main/java/org/apache/jasper/compiler/Validator.java
trunk/src/main/java/org/apache/jasper/runtime/HttpJspBase.java
trunk/src/main/java/org/apache/jasper/runtime/JspContextWrapper.java
trunk/src/main/java/org/apache/jasper/runtime/JspRuntimeLibrary.java
trunk/src/main/java/org/apache/jasper/runtime/JspWriterImpl.java
trunk/src/main/java/org/apache/jasper/runtime/PageContextImpl.java
trunk/src/main/java/org/apache/jasper/servlet/JspServlet.java
trunk/src/main/java/org/apache/jasper/servlet/JspServletWrapper.java
trunk/src/main/java/org/apache/jasper/xmlparser/ASCIIReader.java
trunk/src/main/java/org/apache/jasper/xmlparser/UTF8Reader.java
trunk/src/main/java/org/apache/jasper/xmlparser/XMLEncodingDetector.java
trunk/src/main/java/org/jboss/web/JasperLogger.java
trunk/src/main/java/org/jboss/web/JasperMessages.java
Log:
New i18n for Jasper
Modified: trunk/src/main/java/org/apache/jasper/EmbeddedServletOptions.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/EmbeddedServletOptions.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/EmbeddedServletOptions.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -26,9 +26,8 @@
import javax.servlet.ServletContext;
import org.apache.jasper.compiler.JspConfig;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.compiler.TagPluginManager;
-import org.jboss.logging.Logger;
+import org.jboss.web.JasperLogger;
/**
* A class to hold all init parameters specific to the JSP engine.
@@ -39,9 +38,6 @@
*/
public final class EmbeddedServletOptions implements Options {
- // Logger
- private Logger log = Logger.getLogger(EmbeddedServletOptions.class);
-
private Properties settings = new Properties();
/**
@@ -413,7 +409,7 @@
} else if (keepgen.equalsIgnoreCase("false")) {
this.keepGenerated = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.keepgen"));
+ JasperLogger.ROOT_LOGGER.invalidKeepGeneratedValue(keepgen);
}
}
@@ -425,7 +421,7 @@
} else if (trimsp.equalsIgnoreCase("false")) {
trimSpaces = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.trimspaces"));
+ JasperLogger.ROOT_LOGGER.invalidTrimSpacesValue(trimsp);
}
}
@@ -437,7 +433,7 @@
if (poolingEnabledParam.equalsIgnoreCase("false")) {
this.isPoolingEnabled = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.enablePooling"));
+ JasperLogger.ROOT_LOGGER.invalidEnablePoolingValue(poolingEnabledParam);
}
}
@@ -448,7 +444,7 @@
} else if (mapFile.equalsIgnoreCase("false")) {
this.mappedFile = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.mappedFile"));
+ JasperLogger.ROOT_LOGGER.invalidMappedFileValue(mapFile);
}
}
@@ -459,7 +455,7 @@
} else if (senderr.equalsIgnoreCase("false")) {
this.sendErrorToClient = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.sendErrToClient"));
+ JasperLogger.ROOT_LOGGER.invalidSendErrToClientValue(senderr);
}
}
@@ -470,7 +466,7 @@
} else if (debugInfo.equalsIgnoreCase("false")) {
this.classDebugInfo = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.classDebugInfo"));
+ JasperLogger.ROOT_LOGGER.invalidClassDebugInfoValue(debugInfo);
}
}
@@ -479,7 +475,7 @@
try {
this.checkInterval = Integer.parseInt(checkInterval);
} catch(NumberFormatException ex) {
- log.warn(Localizer.getMessage("jsp.warning.checkInterval"));
+ JasperLogger.ROOT_LOGGER.invalidCheckIntervalValue(checkInterval);
}
}
@@ -488,7 +484,7 @@
try {
this.modificationTestInterval =
Integer.parseInt(modificationTestInterval);
} catch(NumberFormatException ex) {
-
log.warn(Localizer.getMessage("jsp.warning.modificationTestInterval"));
+
JasperLogger.ROOT_LOGGER.invalidModificationTestIntervalValue(modificationTestInterval);
}
}
@@ -499,7 +495,7 @@
} else if (recompileOnFail.equalsIgnoreCase("false")) {
this.recompileOnFail = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.recompileOnFail"));
+ JasperLogger.ROOT_LOGGER.invalidRecompileOnFailValue(recompileOnFail);
}
}
String development = config.getInitParameter("development");
@@ -509,7 +505,7 @@
} else if (development.equalsIgnoreCase("false")) {
this.development = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.development"));
+ JasperLogger.ROOT_LOGGER.invalidDevelopmentValue(development);
}
}
@@ -520,7 +516,7 @@
} else if (suppressSmap.equalsIgnoreCase("false")) {
isSmapSuppressed = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.suppressSmap"));
+ JasperLogger.ROOT_LOGGER.invalidSuppressSmapValue(suppressSmap);
}
}
@@ -531,7 +527,7 @@
} else if (dumpSmap.equalsIgnoreCase("false")) {
isSmapDumped = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.dumpSmap"));
+ JasperLogger.ROOT_LOGGER.invalidDumpSmapValue(dumpSmap);
}
}
@@ -542,7 +538,7 @@
} else if (genCharArray.equalsIgnoreCase("false")) {
genStringAsCharArray = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.genchararray"));
+ JasperLogger.ROOT_LOGGER.invalidGenStrAsCharArrayValue(genCharArray);
}
}
@@ -554,7 +550,7 @@
} else if (errBeanClass.equalsIgnoreCase("false")) {
errorOnUseBeanInvalidClassAttribute = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.errBean"));
+
JasperLogger.ROOT_LOGGER.invalidErrorOnUseBeanInvalidClassAttributeValue(errBeanClass);
}
}
@@ -584,14 +580,13 @@
}
}
if (this.scratchDir == null) {
- log.fatal(Localizer.getMessage("jsp.error.no.scratch.dir"));
+ JasperLogger.ROOT_LOGGER.missingWorkDirectory();
return;
}
if (!(scratchDir.exists() && scratchDir.canRead() &&
scratchDir.canWrite() && scratchDir.isDirectory()))
- log.fatal(Localizer.getMessage("jsp.error.bad.scratch.dir",
- scratchDir.getAbsolutePath()));
+ JasperLogger.ROOT_LOGGER.missingWorkDirectory(scratchDir.getAbsolutePath());
this.compiler = config.getInitParameter("compiler");
@@ -622,7 +617,7 @@
} else if (fork.equalsIgnoreCase("false")) {
this.fork = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.fork"));
+ JasperLogger.ROOT_LOGGER.invalidForkValue(fork);
}
}
@@ -633,7 +628,7 @@
} else if (xpoweredBy.equalsIgnoreCase("false")) {
this.xpoweredBy = false;
} else {
- log.warn(Localizer.getMessage("jsp.warning.xpoweredBy"));
+ JasperLogger.ROOT_LOGGER.invalidXpoweredByValue(xpoweredBy);
}
}
@@ -644,7 +639,7 @@
} else if (displaySourceFragment.equalsIgnoreCase("false")) {
this.displaySourceFragment = false;
} else {
-
log.warn(Localizer.getMessage("jsp.warning.displaySourceFragment"));
+
JasperLogger.ROOT_LOGGER.invalidDisplaySourceFragmentValue(displaySourceFragment);
}
}
Modified: trunk/src/main/java/org/apache/jasper/JspCompilationContext.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/JspCompilationContext.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/JspCompilationContext.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.File;
import java.io.FileNotFoundException;
import java.net.MalformedURLException;
@@ -33,10 +35,10 @@
import org.apache.jasper.compiler.Compiler;
import org.apache.jasper.compiler.JspRuntimeContext;
import org.apache.jasper.compiler.JspUtil;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.compiler.ServletWriter;
import org.apache.jasper.servlet.JasperLoader;
import org.apache.jasper.servlet.JspServletWrapper;
+import org.jboss.web.JasperLogger;
/**
* A place holder for various things that are used through out the JSP
@@ -54,9 +56,6 @@
*/
public class JspCompilationContext {
- protected org.jboss.logging.Logger log =
- org.jboss.logging.Logger.getLogger(JspCompilationContext.class);
-
protected Map<String, URL> tagFileJarUrls;
protected boolean isPackagedTagFile;
@@ -240,7 +239,7 @@
}
}
if (jspCompiler == null) {
- throw new
IllegalStateException(Localizer.getMessage("jsp.error.compiler"));
+ throw MESSAGES.noJavaCompiler();
}
jspCompiler.init(this, jsw);
return jspCompiler;
@@ -251,13 +250,13 @@
try {
compiler = (Compiler) Class.forName(className).newInstance();
} catch (InstantiationException e) {
- log.warn(Localizer.getMessage("jsp.error.compiler"), e);
+ JasperLogger.ROOT_LOGGER.failedLoadingJavaCompiler(className, e);
} catch (IllegalAccessException e) {
- log.warn(Localizer.getMessage("jsp.error.compiler"), e);
+ JasperLogger.ROOT_LOGGER.failedLoadingJavaCompiler(className, e);
} catch (NoClassDefFoundError e) {
- log.info(Localizer.getMessage("jsp.error.compiler"), e);
+ JasperLogger.ROOT_LOGGER.failedLoadingJavaCompiler(className, e);
} catch (ClassNotFoundException e) {
- log.info(Localizer.getMessage("jsp.error.compiler"), e);
+ JasperLogger.ROOT_LOGGER.failedLoadingJavaCompiler(className, e);
}
return compiler;
}
@@ -616,8 +615,7 @@
}
throw ex;
} catch (Exception ex) {
- JasperException je = new JasperException(
- Localizer.getMessage("jsp.error.unable.compile"),
+ JasperException je = new
JasperException(MESSAGES.failedClassCompilation(),
ex);
// Cache compilation exception
jsw.setCompilationException(je);
@@ -637,10 +635,10 @@
String name = getFQCN();
servletClass = jspLoader.loadClass(name);
} catch (ClassNotFoundException cex) {
- throw new
JasperException(Localizer.getMessage("jsp.error.unable.load"),
+ throw new JasperException(MESSAGES.failedClassLoading(),
cex);
} catch (Exception ex) {
- throw new
JasperException(Localizer.getMessage("jsp.error.unable.compile"),
+ throw new JasperException(MESSAGES.failedClassCompilation(),
ex);
}
removed = 0;
@@ -694,10 +692,10 @@
baseUrl = base.toURI().toURL();
outputDir = base.getAbsolutePath() + File.separator + path +
File.separator;
if (!makeOutputDir()) {
- throw new
IllegalStateException(Localizer.getMessage("jsp.error.outputfolder"));
+ throw new IllegalStateException(MESSAGES.noOutputFolder());
}
} catch (MalformedURLException e) {
- throw new
IllegalStateException(Localizer.getMessage("jsp.error.outputfolder"), e);
+ throw new IllegalStateException(MESSAGES.badOutputFolderUrl(e));
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/AttributeParser.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/AttributeParser.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/AttributeParser.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
/**
* Converts a JSP attribute value into the unquoted equivalent. The attribute
* may contain EL expressions, in which case care needs to be taken to avoid any
@@ -303,9 +305,7 @@
i+=3;
return '>';
} else if (ch == quote && strict) {
- String msg = Localizer.getMessage("jsp.error.attribute.noescape",
- input, ""+ quote);
- throw new IllegalArgumentException(msg);
+ throw MESSAGES.missingEscaping(input, "" + quote);
} else {
++i;
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/BeanRepository.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/BeanRepository.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/BeanRepository.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.util.HashMap;
import org.apache.jasper.JasperException;
@@ -47,7 +49,7 @@
if (!(scope == null || scope.equals("page") ||
scope.equals("request")
|| scope.equals("session") ||
scope.equals("application"))) {
- errDispatcher.jspError(n, "jsp.error.usebean.badScope");
+ errDispatcher.jspError(n.getStart(), MESSAGES.badScopeForUseBean());
}
beanTypes.put(s, type);
Modified: trunk/src/main/java/org/apache/jasper/compiler/Compiler.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/Compiler.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/Compiler.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.File;
import java.io.FileNotFoundException;
import java.io.FileOutputStream;
@@ -159,7 +161,7 @@
errDispatcher, true);
}
} catch (NumberFormatException ex) {
- errDispatcher.jspError(ex);
+ errDispatcher.jspError(MESSAGES.malformedLibraryVersionNumber(), ex);
}
}
@@ -304,8 +306,7 @@
osw = new OutputStreamWriter(
new FileOutputStream(javaFileName), javaEncoding);
} catch (UnsupportedEncodingException ex) {
- errDispatcher.jspError("jsp.error.needAlternateJavaEncoding",
- javaEncoding);
+ errDispatcher.jspError(MESSAGES.needAlternateEncoding(javaEncoding));
}
writer = new ServletWriter(new PrintWriter(osw));
Modified: trunk/src/main/java/org/apache/jasper/compiler/DefaultErrorHandler.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/DefaultErrorHandler.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/DefaultErrorHandler.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import org.apache.jasper.JasperException;
/**
@@ -63,34 +65,24 @@
return;
}
- Object[] args = null;
StringBuilder buf = new StringBuilder();
-
for (int i=0; i < details.length; i++) {
if (details[i].getJspBeginLineNumber() >= 0) {
- args = new Object[] {
- new Integer(details[i].getJspBeginLineNumber()),
- details[i].getJspFileName() };
buf.append("\n\n");
-
buf.append(Localizer.getMessage("jsp.error.single.line.number",
- args));
+ buf.append(MESSAGES.errorInJspFile(details[i].getJspBeginLineNumber(),
details[i].getJspFileName()));
buf.append("\n");
buf.append(details[i].getErrorMessage());
buf.append("\n");
buf.append(details[i].getJspExtract());
} else {
- args = new Object[] {
- new Integer(details[i].getJavaLineNumber()) };
buf.append("\n\n");
- buf.append(Localizer.getMessage("jsp.error.java.line.number",
- args));
+ buf.append(MESSAGES.errorInJavaFile(details[i].getJavaLineNumber()));
buf.append("\n");
buf.append(details[i].getErrorMessage());
}
}
buf.append("\n\nStacktrace:");
- throw new JasperException(
- Localizer.getMessage("jsp.error.unable.compile") + ":
" + buf);
+ throw new JasperException(MESSAGES.failedClassCompilation(buf.toString()));
}
/**
@@ -101,9 +93,7 @@
*/
public void javacError(String errorReport, Exception exception)
throws JasperException {
-
- throw new JasperException(
- Localizer.getMessage("jsp.error.unable.compile"), exception);
+ throw new JasperException(MESSAGES.failedClassCompilation(), exception);
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/ErrorDispatcher.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/ErrorDispatcher.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/ErrorDispatcher.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -16,11 +16,7 @@
*/
package org.apache.jasper.compiler;
-import java.io.BufferedReader;
-import java.io.IOException;
-import java.io.StringReader;
import java.net.MalformedURLException;
-import java.util.ArrayList;
import org.apache.jasper.JasperException;
import org.apache.jasper.JspCompilationContext;
@@ -62,263 +58,6 @@
}
/*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param errCode Error code
- */
- public void jspError(String errCode) throws JasperException {
- dispatch(null, errCode, null, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param where Error location
- * @param errCode Error code
- */
- public void jspError(Mark where, String errCode) throws JasperException {
- dispatch(where, errCode, null, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param n Node that caused the error
- * @param errCode Error code
- */
- public void jspError(Node n, String errCode) throws JasperException {
- dispatch(n.getStart(), errCode, null, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param errCode Error code
- * @param arg Argument for parametric replacement
- */
- public void jspError(String errCode, String arg) throws JasperException {
- dispatch(null, errCode, new Object[] {arg}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param where Error location
- * @param errCode Error code
- * @param arg Argument for parametric replacement
- */
- public void jspError(Mark where, String errCode, String arg)
- throws JasperException {
- dispatch(where, errCode, new Object[] {arg}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param n Node that caused the error
- * @param errCode Error code
- * @param arg Argument for parametric replacement
- */
- public void jspError(Node n, String errCode, String arg)
- throws JasperException {
- dispatch(n.getStart(), errCode, new Object[] {arg}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param errCode Error code
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- */
- public void jspError(String errCode, String arg1, String arg2)
- throws JasperException {
- dispatch(null, errCode, new Object[] {arg1, arg2}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param errCode Error code
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- * @param arg3 Third argument for parametric replacement
- */
- public void jspError(String errCode, String arg1, String arg2, String arg3)
- throws JasperException {
- dispatch(null, errCode, new Object[] {arg1, arg2, arg3}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param where Error location
- * @param errCode Error code
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- */
- public void jspError(Mark where, String errCode, String arg1, String arg2)
- throws JasperException {
- dispatch(where, errCode, new Object[] {arg1, arg2}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param where Error location
- * @param errCode Error code
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- * @param arg3 Third argument for parametric replacement
- */
-
- public void jspError(Mark where, String errCode, String arg1, String arg2,
- String arg3)
- throws JasperException {
- dispatch(where, errCode, new Object[] {arg1, arg2, arg3}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param n Node that caused the error
- * @param errCode Error code
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- */
-
- public void jspError(Node n, String errCode, String arg1, String arg2)
- throws JasperException {
- dispatch(n.getStart(), errCode, new Object[] {arg1, arg2}, null);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param n Node that caused the error
- * @param errCode Error code
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- * @param arg3 Third argument for parametric replacement
- */
-
- public void jspError(Node n, String errCode, String arg1, String arg2,
- String arg3)
- throws JasperException {
- dispatch(n.getStart(), errCode, new Object[] {arg1, arg2, arg3}, null);
- }
-
- /*
- * Dispatches the given parsing exception to the configured error handler.
- *
- * @param e Parsing exception
- */
- public void jspError(Exception e) throws JasperException {
- dispatch(null, null, null, e);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param errCode Error code
- * @param arg Argument for parametric replacement
- * @param e Parsing exception
- */
- public void jspError(String errCode, String arg, Exception e)
- throws JasperException {
- dispatch(null, errCode, new Object[] {arg}, e);
- }
-
- /*
- * Dispatches the given JSP parse error to the configured error handler.
- *
- * The given error code is localized. If it is not found in the
- * resource bundle for localized error messages, it is used as the error
- * message.
- *
- * @param n Node that caused the error
- * @param errCode Error code
- * @param arg Argument for parametric replacement
- * @param e Parsing exception
- */
- public void jspError(Node n, String errCode, String arg, Exception e)
- throws JasperException {
- dispatch(n.getStart(), errCode, new Object[] {arg}, e);
- }
-
- /**
- * Parses the given error message into an array of javac compilation error
- * messages (one per javac compilation error line number).
- *
- * @param errMsg Error message
- * @param fname Name of Java source file whose compilation failed
- * @param page Node representation of JSP page from which the Java source
- * file was generated
- *
- * @return Array of javac compilation errors, or null if the given error
- * message does not contain any compilation error line numbers
- */
- public static JavacErrorDetail[] parseJavacErrors(String errMsg,
- String fname,
- Node.Nodes page)
- throws JasperException, IOException {
-
- return parseJavacMessage(errMsg, fname, page);
- }
-
- /*
* Dispatches the given javac compilation errors to the configured error
* handler.
*
@@ -345,10 +84,19 @@
}
- //*********************************************************************
- // Private utility methods
+ public void jspError(String errorMessage) throws JasperException {
+ jspError(null, errorMessage, null);
+ }
- /*
+ public void jspError(String errorMessage, Exception e) throws JasperException {
+ jspError(null, errorMessage, e);
+ }
+
+ public void jspError(Mark where, String errorMessage) throws JasperException {
+ jspError(where, errorMessage, null);
+ }
+
+ /**
* Dispatches the given JSP parse error to the configured error handler.
*
* The given error code is localized. If it is not found in the
@@ -356,28 +104,18 @@
* message.
*
* @param where Error location
- * @param errCode Error code
+ * @param errorMessage The error message
* @param args Arguments for parametric replacement
* @param e Parsing exception
*/
- private void dispatch(Mark where, String errCode, Object[] args,
- Exception e) throws JasperException {
- String file = null;
- String errMsg = null;
- int line = -1;
- int column = -1;
- boolean hasLocation = false;
+ public void jspError(Mark where, String errorMessage, Exception e) throws
JasperException {
+ String file = null;
+ int line = -1;
+ int column = -1;
+ boolean hasLocation = false;
- // Localize
- if (errCode != null) {
- errMsg = Localizer.getMessage(errCode, args);
- } else if (e != null) {
- // give a hint about what's wrong
- errMsg = e.getMessage();
- }
-
- // Get error location
- if (where != null) {
+ // Get error location
+ if (where != null) {
if (jspcMode) {
// Get the full URL of the resource that caused the error
try {
@@ -391,109 +129,25 @@
// disclose any local filesystem details
file = where.getFile();
}
- line = where.getLineNumber();
- column = where.getColumnNumber();
- hasLocation = true;
- }
+ line = where.getLineNumber();
+ column = where.getColumnNumber();
+ hasLocation = true;
+ }
- // Get nested exception
- Exception nestedEx = e;
- if ((e instanceof SAXException)
- && (((SAXException) e).getException() != null)) {
- nestedEx = ((SAXException) e).getException();
- }
+ // Get nested exception
+ Exception nestedEx = e;
+ if ((e instanceof SAXException)
+ && (((SAXException) e).getException() != null)) {
+ nestedEx = ((SAXException) e).getException();
+ }
- if (hasLocation) {
- errHandler.jspError(file, line, column, errMsg, nestedEx);
- } else {
- errHandler.jspError(errMsg, nestedEx);
- }
- }
-
- /*
- * Parses the given Java compilation error message, which may contain one
- * or more compilation errors, into an array of JavacErrorDetail instances.
- *
- * Each JavacErrorDetail instance contains the information about a single
- * compilation error.
- *
- * @param errMsg Compilation error message that was generated by the
- * javac compiler
- * @param fname Name of Java source file whose compilation failed
- * @param page Node representation of JSP page from which the Java source
- * file was generated
- *
- * @return Array of JavacErrorDetail instances corresponding to the
- * compilation errors
- */
- private static JavacErrorDetail[] parseJavacMessage(
- String errMsg, String fname, Node.Nodes page)
- throws IOException, JasperException {
-
- ArrayList<JavacErrorDetail> errors = new
ArrayList<JavacErrorDetail>();
- StringBuilder errMsgBuf = null;
- int lineNum = -1;
- JavacErrorDetail javacError = null;
-
- BufferedReader reader = new BufferedReader(new StringReader(errMsg));
-
- /*
- * Parse compilation errors. Each compilation error consists of a file
- * path and error line number, followed by a number of lines describing
- * the error.
- */
- String line = null;
- while ((line = reader.readLine()) != null) {
-
- /*
- * Error line number is delimited by set of colons.
- * Ignore colon following drive letter on Windows (fromIndex = 2).
- * XXX Handle deprecation warnings that don't have line info
- */
- int beginColon = line.indexOf(':', 2);
- int endColon = line.indexOf(':', beginColon + 1);
- if ((beginColon >= 0) && (endColon >= 0)) {
- if (javacError != null) {
- // add previous error to error vector
- errors.add(javacError);
- }
-
- String lineNumStr = line.substring(beginColon + 1, endColon);
- try {
- lineNum = Integer.parseInt(lineNumStr);
- } catch (NumberFormatException e) {
- lineNum = -1;
- }
-
- errMsgBuf = new StringBuilder();
-
- javacError = createJavacError(fname, page, errMsgBuf, lineNum);
- }
-
- // Ignore messages preceding first error
- if (errMsgBuf != null) {
- errMsgBuf.append(line);
- errMsgBuf.append("\n");
- }
+ if (hasLocation) {
+ errHandler.jspError(file, line, column, errorMessage, nestedEx);
+ } else {
+ errHandler.jspError(errorMessage, nestedEx);
}
-
- // Add last error to error vector
- if (javacError != null) {
- errors.add(javacError);
- }
-
- reader.close();
-
- JavacErrorDetail[] errDetails = null;
- if (errors.size() > 0) {
- errDetails = new JavacErrorDetail[errors.size()];
- errors.toArray(errDetails);
- }
-
- return errDetails;
}
-
/**
* @param fname
* @param page
@@ -504,7 +158,7 @@
*/
public static JavacErrorDetail createJavacError(String fname,
Node.Nodes page, StringBuilder errMsgBuf, int lineNum)
- throws JasperException {
+ throws JasperException {
return createJavacError(fname, page, errMsgBuf, lineNum, null);
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/Generator.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/Generator.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/Generator.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.beans.BeanInfo;
import java.beans.IntrospectionException;
import java.beans.Introspector;
@@ -1226,7 +1228,7 @@
// depending on a compiler flag.
if (ctxt.getOptions()
.getErrorOnUseBeanInvalidClassAttribute()) {
- err.jspError(n, "jsp.error.invalid.bean", klass);
+ err.jspError(n.getStart(),
MESSAGES.invalidUseBeanAttributeClass(klass));
}
if (canonicalName == null) {
// Doing our best here to get a canonical name
@@ -2829,8 +2831,8 @@
} else {
m = handlerInfo.getSetterMethod(localName);
if (m == null) {
- err.jspError(n, "jsp.error.unable.to_find_method", attr
- .getName());
+ err.jspError(n.getStart(), MESSAGES.cannotFindSetterMethod(attr
+ .getName()));
}
c = m.getParameterTypes();
// XXX assert(c.length > 0)
@@ -3924,8 +3926,7 @@
.getPropertyEditorClass());
}
} catch (IntrospectionException ie) {
- err.jspError(n, "jsp.error.introspect.taghandler",
- tagHandlerClass.getName(), ie);
+ err.jspError(n.getStart(),
MESSAGES.errorIntrospectingTagHandler(tagHandlerClass.getName()), ie);
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/ImplicitTagLibraryInfo.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/ImplicitTagLibraryInfo.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/ImplicitTagLibraryInfo.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.InputStream;
import java.util.Collection;
import java.util.Hashtable;
@@ -82,7 +84,7 @@
jspversion = JSP_VERSION;
if (!tagdir.startsWith(WEB_INF_TAGS)) {
- err.jspError("jsp.error.invalid.tagdir", tagdir);
+ err.jspError(MESSAGES.invalidTagFileDirectory(tagdir));
}
// Determine the value of the <short-name> subelement of the
@@ -151,21 +153,21 @@
reader.getElementText();
} else {
// All other elements are invalid
- err.jspError("jsp.error.invalid.implicit",
path);
+ err.jspError(MESSAGES.invalidImplicitTld(path));
}
}
try {
double version = Double.parseDouble(this.jspversion);
if (version < 2.0) {
-
err.jspError("jsp.error.invalid.implicit.version", path);
+
err.jspError(MESSAGES.invalidImplicitTldVersion(path));
}
} catch (NumberFormatException e) {
-
err.jspError("jsp.error.invalid.implicit.version", path);
+ err.jspError(MESSAGES.invalidImplicitTldVersion(path));
}
}
} catch (XMLStreamException e) {
- err.jspError("jsp.error.invalid.implicit", path, e);
+ err.jspError(MESSAGES.invalidImplicitTld(path), e);
} finally {
if (is != null) {
try {
Modified: trunk/src/main/java/org/apache/jasper/compiler/JavacErrorDetail.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/JavacErrorDetail.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/JavacErrorDetail.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.BufferedReader;
import java.io.FileInputStream;
import java.io.IOException;
@@ -99,7 +101,7 @@
if (jspLines.length < jspBeginLineNum) {
// Avoid ArrayIndexOutOfBoundsException
// Probably bug 48494 but could be some other cause
- jspExtract = Localizer.getMessage("jsp.error.bug48494");
+ jspExtract = MESSAGES.errorDisplayingJspExtract();
return;
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/JspConfig.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/JspConfig.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/JspConfig.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -55,6 +55,7 @@
import org.apache.catalina.Globals;
import org.apache.jasper.JasperException;
import org.jboss.logging.Logger;
+import org.jboss.web.JasperLogger;
/**
* Handles the jsp-config element in WEB_INF/web.xml. This is used
@@ -149,9 +150,7 @@
boolean isStar = "*".equals(extension);
if ((path == null && (extension == null || isStar))
|| (path != null && !isStar)) {
- log.warn(Localizer.getMessage(
-
"jsp.warning.bad.urlpattern.propertygroup",
- urlPattern));
+
JasperLogger.COMPILER_LOGGER.invalidJspPropertyGroupsUrlPattern(urlPattern);
continue;
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/JspDocumentParser.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/JspDocumentParser.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/JspDocumentParser.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -16,6 +16,8 @@
*/
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.CharArrayWriter;
import java.io.FileNotFoundException;
import java.io.IOException;
@@ -204,14 +206,14 @@
pageNodes = new Node.Nodes(dummyRoot);
} catch (IOException ioe) {
- jspDocParser.err.jspError("jsp.error.data.file.read", path, ioe);
+ jspDocParser.err.jspError(MESSAGES.errorReadingFile(path), ioe);
} catch (SAXParseException e) {
jspDocParser.err.jspError
(new Mark(jspDocParser.ctxt, path, e.getLineNumber(),
e.getColumnNumber()),
- e.getMessage());
+ MESSAGES.errorParsingFile(path), e);
} catch (Exception e) {
- jspDocParser.err.jspError(e);
+ jspDocParser.err.jspError(MESSAGES.errorParsingFile(path), e);
}
return pageNodes;
@@ -279,7 +281,7 @@
if (JSP_URI.equals(uri) && TEXT_ACTION.equals(current.getLocalName())
&& "jsp".equals(currentPrefix)) {
throw new SAXParseException(
- Localizer.getMessage("jsp.error.text.has_subelement"),
+ MESSAGES.invalidJspTextSubelements(),
locator);
}
@@ -537,10 +539,7 @@
lastCh = 0;
for (;; i++) {
if (i >= charBuffer.length()) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.unterminated",
- (char) elType + "{"),
+ throw new SAXParseException(MESSAGES.unterminatedTag((char)
elType + "{"),
locator);
}
@@ -668,9 +667,7 @@
for (int i = 0; i < children.size(); i++) {
Node child = children.getNode(i);
if (!(child instanceof Node.NamedAttribute)) {
- throw new SAXParseException(Localizer.getMessage(
- "jasper.error.emptybodycontent.nonempty",
- current.qName), locator);
+ throw new
SAXParseException(MESSAGES.invalidEmptyTagSubelements(current.qName), locator);
}
}
}
@@ -787,8 +784,7 @@
try {
taglibInfo = getTaglibInfo(prefix, uri);
} catch (JasperException je) {
- throw new SAXParseException(
- Localizer.getMessage("jsp.error.could.not.add.taglibraries",
je.getMessage()),
+ throw new
SAXParseException(MESSAGES.errorAddingTagLibraries(je.getMessage()),
locator,
je);
}
@@ -835,8 +831,7 @@
if (localName.equals(ROOT_ACTION)) {
if (!(current instanceof Node.Root)) {
- throw new SAXParseException(
- Localizer.getMessage("jsp.error.nested_jsproot"),
+ throw new SAXParseException(MESSAGES.nestedJspRoot(),
locator);
}
node =
@@ -852,10 +847,7 @@
}
} else if (localName.equals(PAGE_DIRECTIVE_ACTION)) {
if (isTagFile) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.action.istagfile",
- localName),
+ throw new
SAXParseException(MESSAGES.invalidDirectiveInTagFile(localName),
locator);
}
node =
@@ -885,10 +877,7 @@
if (scriptlessBodyNode != null) {
// We're nested inside a node whose body is
// declared to be scriptless
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.no.scriptlets",
- localName),
+ throw new SAXParseException(MESSAGES.invalidScriptingElement(),
locator);
}
node =
@@ -902,10 +891,7 @@
if (scriptlessBodyNode != null) {
// We're nested inside a node whose body is
// declared to be scriptless
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.no.scriptlets",
- localName),
+ throw new SAXParseException(MESSAGES.invalidScriptingElement(),
locator);
}
node =
@@ -919,10 +905,7 @@
if (scriptlessBodyNode != null) {
// We're nested inside a node whose body is
// declared to be scriptless
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.no.scriptlets",
- localName),
+ throw new SAXParseException(MESSAGES.invalidScriptingElement(),
locator);
}
node =
@@ -1039,10 +1022,7 @@
current);
} else if (localName.equals(TAG_DIRECTIVE_ACTION)) {
if (!isTagFile) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.action.isnottagfile",
- localName),
+ throw new
SAXParseException(MESSAGES.invalidDirectiveInTagFile(localName),
locator);
}
node =
@@ -1060,10 +1040,7 @@
}
} else if (localName.equals(ATTRIBUTE_DIRECTIVE_ACTION)) {
if (!isTagFile) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.action.isnottagfile",
- localName),
+ throw new
SAXParseException(MESSAGES.invalidDirectiveInTagFile(localName),
locator);
}
node =
@@ -1076,10 +1053,7 @@
current);
} else if (localName.equals(VARIABLE_DIRECTIVE_ACTION)) {
if (!isTagFile) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.action.isnottagfile",
- localName),
+ throw new
SAXParseException(MESSAGES.invalidDirectiveInTagFile(localName),
locator);
}
node =
@@ -1092,10 +1066,7 @@
current);
} else if (localName.equals(INVOKE_ACTION)) {
if (!isTagFile) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.action.isnottagfile",
- localName),
+ throw new SAXParseException(MESSAGES.invalidActionInTagFile(localName),
locator);
}
node =
@@ -1108,10 +1079,7 @@
current);
} else if (localName.equals(DOBODY_ACTION)) {
if (!isTagFile) {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.action.isnottagfile",
- localName),
+ throw new SAXParseException(MESSAGES.invalidActionInTagFile(localName),
locator);
}
node =
@@ -1140,10 +1108,7 @@
start,
current);
} else {
- throw new SAXParseException(
- Localizer.getMessage(
- "jsp.error.xml.badStandardAction",
- localName),
+ throw new SAXParseException(MESSAGES.invalidStandardAction(localName),
locator);
}
@@ -1174,8 +1139,7 @@
TagInfo tagInfo = tagLibInfo.getTag(localName);
TagFileInfo tagFileInfo = tagLibInfo.getTagFile(localName);
if (tagInfo == null && tagFileInfo == null) {
- throw new SAXException(
- Localizer.getMessage("jsp.error.xml.bad_tag", localName,
uri));
+ throw new SAXException(MESSAGES.unknownTag(localName, uri));
}
Class tagHandlerClass = null;
if (tagInfo != null) {
@@ -1184,10 +1148,7 @@
tagHandlerClass =
ctxt.getClassLoader().loadClass(handlerClassName);
} catch (Exception e) {
- throw new SAXException(
- Localizer.getMessage("jsp.error.loadclass.taghandler",
- handlerClassName,
- qName),
+ throw new SAXException(MESSAGES.errorLoadingTagHandler(handlerClassName,
qName),
e);
}
}
@@ -1318,11 +1279,7 @@
elemType = DECLARATION_ACTION;
if (scriptingElem instanceof Node.Expression)
elemType = EXPRESSION_ACTION;
- String msg =
- Localizer.getMessage(
- "jsp.error.parse.xml.scripting.invalid.body",
- elemType);
- throw new SAXException(msg);
+ throw new SAXException(MESSAGES.invalidScriptingBody(elemType));
}
}
}
@@ -1345,12 +1302,11 @@
try {
parserController.parse(fname, parent, null);
} catch (FileNotFoundException fnfe) {
- throw new SAXParseException(
- Localizer.getMessage("jsp.error.file.not.found", fname),
+ throw new SAXParseException(MESSAGES.fileNotFound(fname),
locator,
fnfe);
} catch (Exception e) {
- throw new SAXException(e);
+ throw new SAXException(MESSAGES.errorParsingFile(fname), e);
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/JspReader.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/JspReader.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/JspReader.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.CharArrayWriter;
import java.io.FileNotFoundException;
import java.io.IOException;
@@ -29,8 +31,7 @@
import org.apache.jasper.JasperException;
import org.apache.jasper.JspCompilationContext;
-import org.jboss.logging.Logger;
-import org.jboss.logging.Logger;
+import org.jboss.web.JasperLogger;
/**
* JspReader is an input buffer for the JSP parser. It should allow
@@ -51,11 +52,6 @@
class JspReader {
/**
- * Logger.
- */
- private Logger log = Logger.getLogger(JspReader.class);
-
- /**
* The current spot in the file.
*/
private Mark current;
@@ -444,10 +440,10 @@
}
// Check end of quote, skip closing quote:
if (ch == -1) {
- err.jspError(mark(), "jsp.error.quotes.unterminated");
+ err.jspError(mark(), MESSAGES.unterminatedQuotes());
}
} else {
- err.jspError(mark(), "jsp.error.attr.quoted");
+ err.jspError(mark(), MESSAGES.unquotedAttributeValue());
}
} else {
if (!isDelimiter()) {
@@ -578,13 +574,11 @@
try {
reader.close();
} catch (Exception any) {
- if(log.isDebugEnabled()) {
- log.debug("Exception closing reader: ", any);
- }
+ JasperLogger.COMPILER_LOGGER.errorClosingReader(any);
}
}
- err.jspError("jsp.error.file.already.registered", file);
+ err.jspError(MESSAGES.invalidRecursiveInclude(file));
}
currFileId = fileid;
@@ -603,18 +597,15 @@
longName, encoding);
}
} catch (Throwable ex) {
- log.error("Exception parsing file ", ex);
// Pop state being constructed:
popFile();
- err.jspError("jsp.error.file.cannot.read", file);
+ err.jspError(MESSAGES.errorReadingFile(file));
} finally {
if (reader != null) {
try {
reader.close();
} catch (Exception any) {
- if(log.isDebugEnabled()) {
- log.debug("Exception closing reader: ", any);
- }
+ JasperLogger.COMPILER_LOGGER.errorClosingReader(any);
}
}
}
@@ -639,7 +630,7 @@
String fName = getFile(currFileId);
currFileId = unregisterSourceFile(fName);
if (currFileId < -1) {
- err.jspError("jsp.error.file.not.registered", fName);
+ err.jspError(MESSAGES.invalidInclude(fName));
}
Mark previous = current.popStream();
Modified: trunk/src/main/java/org/apache/jasper/compiler/JspRuntimeContext.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/JspRuntimeContext.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/JspRuntimeContext.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -39,8 +39,7 @@
import org.apache.jasper.runtime.JspFactoryImpl;
import org.apache.jasper.security.SecurityClassLoad;
import org.apache.jasper.servlet.JspServletWrapper;
-import org.jboss.logging.Logger;
-import org.jboss.logging.Logger;
+import org.jboss.web.JasperLogger;
/**
* Class for tracking JSP compile time file dependencies when the
@@ -57,9 +56,6 @@
*/
public final class JspRuntimeContext {
- // Logger
- private Logger log = Logger.getLogger(JspRuntimeContext.class);
-
/*
* Counts how many times the webapp's JSPs have been reloaded.
*/
@@ -115,15 +111,8 @@
parentClassLoader = this.getClass().getClassLoader();
}
- if (log.isDebugEnabled()) {
- if (parentClassLoader != null) {
- log.debug(Localizer.getMessage("jsp.message.parent_class_loader_is",
- parentClassLoader.toString()));
- } else {
- log.debug(Localizer.getMessage("jsp.message.parent_class_loader_is",
- "<none>"));
- }
- }
+ JasperLogger.COMPILER_LOGGER.logParentClassLoader((parentClassLoader != null)
+ ? parentClassLoader.toString() : "[none]");
initClassPath();
@@ -347,9 +336,7 @@
classpath = cpath.toString() + cp;
- if(log.isDebugEnabled()) {
- log.debug("Compilation classpath initialized: " + getClassPath());
- }
+ JasperLogger.COMPILER_LOGGER.logCompilationClasspath(getClassPath());
}
/**
Modified: trunk/src/main/java/org/apache/jasper/compiler/JspUtil.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/JspUtil.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/JspUtil.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.CharArrayWriter;
import java.io.IOException;
import java.io.InputStream;
@@ -205,7 +207,7 @@
throws JasperException {
if (scope != null && !scope.equals("page") &&
!scope.equals("request")
&& !scope.equals("session") &&
!scope.equals("application")) {
- err.jspError(n, "jsp.error.invalid.scope", scope);
+ err.jspError(n.getStart(), MESSAGES.invalidScope(scope));
}
}
@@ -244,8 +246,7 @@
temp.addElement( attrName );
// Check if this value appear in the attribute of the node
if (n.getAttributeValue(attrName) != null) {
- err.jspError(n, "jsp.error.duplicate.name.jspattribute",
- attrName);
+ err.jspError(n.getStart(), MESSAGES.duplicateAttribute(attrName));
}
}
else {
@@ -280,8 +281,7 @@
// If mandatory attribute is missing then the exception is thrown
if (!valid)
- err.jspError(start, "jsp.error.mandatory.attribute", typeOfTag,
- missingAttribute);
+ err.jspError(start, MESSAGES.missingMandatoryAttribute(typeOfTag,
missingAttribute));
// Check to see if there are any more attributes for the specified tag.
int attrLeftLength = temp.size();
@@ -301,8 +301,7 @@
}
}
if (!valid)
- err.jspError(start, "jsp.error.invalid.attribute", typeOfTag,
- attribute);
+ err.jspError(start, MESSAGES.invalidAttribute(typeOfTag, attribute));
}
// XXX *could* move EL-syntax validation here... (sb)
}
@@ -815,7 +814,7 @@
String jarEntryName = fname.substring(1, fname.length());
ZipEntry jarEntry = jarFile.getEntry(jarEntryName);
if (jarEntry == null) {
- err.jspError("jsp.error.file.not.found", fname);
+ err.jspError(MESSAGES.fileNotFound(fname));
}
in = jarFile.getInputStream(jarEntry);
} else {
@@ -823,7 +822,7 @@
}
if (in == null) {
- err.jspError("jsp.error.file.not.found", fname);
+ err.jspError(MESSAGES.fileNotFound(fname));
}
return in;
@@ -871,7 +870,7 @@
index = path.lastIndexOf(".tag");
if (index == -1) {
- err.jspError("jsp.error.tagfile.badSuffix", path);
+ err.jspError(MESSAGES.invalidTagFileName(path));
}
//It's tempting to remove the ".tag" suffix here, but we
can't.
@@ -894,7 +893,7 @@
className = getClassNameBase(urn);
begin = index + META_INF_TAGS.length();
} else {
- err.jspError("jsp.error.tagfile.illegalPath", path);
+ err.jspError(MESSAGES.invalidTagFileDirectory(path));
}
}
@@ -1066,7 +1065,7 @@
try {
reader = new InputStreamReader(in, encoding);
} catch (UnsupportedEncodingException ex) {
- err.jspError("jsp.error.unsupported.encoding", encoding);
+ err.jspError(MESSAGES.unsupportedEncoding(encoding));
}
return reader;
Deleted: trunk/src/main/java/org/apache/jasper/compiler/Localizer.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/Localizer.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/Localizer.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -1,166 +0,0 @@
-/*
- * Licensed to the Apache Software Foundation (ASF) under one or more
- * contributor license agreements. See the NOTICE file distributed with
- * this work for additional information regarding copyright ownership.
- * The ASF licenses this file to You under the Apache License, Version 2.0
- * (the "License"); you may not use this file except in compliance with
- * the License. You may obtain a copy of the License at
- *
- *
http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-package org.apache.jasper.compiler;
-
-import java.text.MessageFormat;
-import java.util.MissingResourceException;
-import java.util.ResourceBundle;
-
-/**
- * Class responsible for converting error codes to corresponding localized
- * error messages.
- *
- * @author Jan Luehe
- */
-public class Localizer {
-
- private static ResourceBundle bundle = null;
-
- static {
- try {
- bundle = ResourceBundle.getBundle(
- "org.apache.jasper.resources.LocalStrings");
- } catch (Throwable t) {
- t.printStackTrace();
- }
- }
-
- /*
- * Returns the localized error message corresponding to the given error
- * code.
- *
- * If the given error code is not defined in the resource bundle for
- * localized error messages, it is used as the error message.
- *
- * @param errCode Error code to localize
- *
- * @return Localized error message
- */
- public static String getMessage(String errCode) {
- if (bundle == null) {
- return errCode;
- }
- String errMsg = errCode;
- try {
- errMsg = bundle.getString(errCode);
- } catch (MissingResourceException e) {
- }
- return errMsg;
- }
-
- /*
- * Returns the localized error message corresponding to the given error
- * code.
- *
- * If the given error code is not defined in the resource bundle for
- * localized error messages, it is used as the error message.
- *
- * @param errCode Error code to localize
- * @param arg Argument for parametric replacement
- *
- * @return Localized error message
- */
- public static String getMessage(String errCode, String arg) {
- return getMessage(errCode, new Object[] {arg});
- }
-
- /*
- * Returns the localized error message corresponding to the given error
- * code.
- *
- * If the given error code is not defined in the resource bundle for
- * localized error messages, it is used as the error message.
- *
- * @param errCode Error code to localize
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- *
- * @return Localized error message
- */
- public static String getMessage(String errCode, String arg1, String arg2) {
- return getMessage(errCode, new Object[] {arg1, arg2});
- }
-
- /*
- * Returns the localized error message corresponding to the given error
- * code.
- *
- * If the given error code is not defined in the resource bundle for
- * localized error messages, it is used as the error message.
- *
- * @param errCode Error code to localize
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- * @param arg3 Third argument for parametric replacement
- *
- * @return Localized error message
- */
- public static String getMessage(String errCode, String arg1, String arg2,
- String arg3) {
- return getMessage(errCode, new Object[] {arg1, arg2, arg3});
- }
-
- /*
- * Returns the localized error message corresponding to the given error
- * code.
- *
- * If the given error code is not defined in the resource bundle for
- * localized error messages, it is used as the error message.
- *
- * @param errCode Error code to localize
- * @param arg1 First argument for parametric replacement
- * @param arg2 Second argument for parametric replacement
- * @param arg3 Third argument for parametric replacement
- * @param arg4 Fourth argument for parametric replacement
- *
- * @return Localized error message
- */
- public static String getMessage(String errCode, String arg1, String arg2,
- String arg3, String arg4) {
- return getMessage(errCode, new Object[] {arg1, arg2, arg3, arg4});
- }
-
- /*
- * Returns the localized error message corresponding to the given error
- * code.
- *
- * If the given error code is not defined in the resource bundle for
- * localized error messages, it is used as the error message.
- *
- * @param errCode Error code to localize
- * @param args Arguments for parametric replacement
- *
- * @return Localized error message
- */
- public static String getMessage(String errCode, Object[] args) {
- if (bundle == null) {
- return errCode;
- }
- String errMsg = errCode;
- try {
- errMsg = bundle.getString(errCode);
- if (args != null) {
- MessageFormat formatter = new MessageFormat(errMsg);
- errMsg = formatter.format(args);
- }
- } catch (MissingResourceException e) {
- }
-
- return errMsg;
- }
-}
Modified: trunk/src/main/java/org/apache/jasper/compiler/PageInfo.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/PageInfo.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/PageInfo.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -16,6 +16,8 @@
*/
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.util.ArrayList;
import java.util.Collection;
import java.util.HashMap;
@@ -377,9 +379,9 @@
if (!"java".equalsIgnoreCase(value)) {
if (pagedir)
- err.jspError(n, "jsp.error.page.language.nonjava");
+ err.jspError(n.getStart(), MESSAGES.unsupportedPageDirectiveLanguage());
else
- err.jspError(n, "jsp.error.tag.language.nonjava");
+ err.jspError(n.getStart(), MESSAGES.unsupportedTagDirectiveLanguage());
}
language = value;
@@ -459,12 +461,12 @@
buffer = 0;
else {
if (value == null || !value.endsWith("kb"))
- err.jspError(n, "jsp.error.page.invalid.buffer");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveBufferSize());
try {
Integer k = new Integer(value.substring(0, value.length()-2));
buffer = k.intValue() * 1024;
} catch (NumberFormatException e) {
- err.jspError(n, "jsp.error.page.invalid.buffer");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveBufferSize());
}
}
@@ -478,12 +480,12 @@
buffer = 0;
else {
if (value == null || !value.endsWith("kb"))
- err.jspError("jsp.error.page.invalid.buffer");
+ err.jspError(MESSAGES.invalidPageDirectiveBufferSize());
try {
Integer k = new Integer(value.substring(0, value.length()-2));
buffer = k.intValue() * 1024;
} catch (NumberFormatException e) {
- err.jspError("jsp.error.page.invalid.buffer");
+ err.jspError(MESSAGES.invalidPageDirectiveBufferSize());
}
}
@@ -510,7 +512,7 @@
else if ("false".equalsIgnoreCase(value))
isSession = false;
else
- err.jspError(n, "jsp.error.page.invalid.session");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveSession());
session = value;
}
@@ -535,7 +537,7 @@
else if ("false".equalsIgnoreCase(value))
isAutoFlush = false;
else
- err.jspError(n, "jsp.error.autoFlush.invalid");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveAutoFlush());
autoFlush = value;
}
@@ -560,7 +562,7 @@
else if ("false".equalsIgnoreCase(value))
isThreadSafe = false;
else
- err.jspError(n, "jsp.error.page.invalid.isthreadsafe");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveIsThreadSafe());
isThreadSafeValue = value;
}
@@ -609,7 +611,7 @@
else if ("false".equalsIgnoreCase(value))
isErrorPage = false;
else
- err.jspError(n, "jsp.error.page.invalid.iserrorpage");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveIsErrorPage());
isErrorPageValue = value;
}
@@ -636,9 +638,9 @@
isELIgnored = false;
else {
if (pagedir)
- err.jspError(n, "jsp.error.page.invalid.iselignored");
+ err.jspError(n.getStart(), MESSAGES.invalidPageDirectiveIsElIgnored());
else
- err.jspError(n, "jsp.error.tag.invalid.iselignored");
+ err.jspError(n.getStart(), MESSAGES.invalidTagDirectiveIsElIgnored());
}
isELIgnoredValue = value;
@@ -657,9 +659,9 @@
deferredSyntaxAllowedAsLiteral = false;
else {
if (pagedir)
- err.jspError(n,
"jsp.error.page.invalid.deferredsyntaxallowedasliteral");
+ err.jspError(n.getStart(),
MESSAGES.invalidPageDirectiveDeferredSyntaxAllowedAsLiteral());
else
- err.jspError(n,
"jsp.error.tag.invalid.deferredsyntaxallowedasliteral");
+ err.jspError(n.getStart(),
MESSAGES.invalidTagDirectiveDeferredSyntaxAllowedAsLiteral());
}
deferredSyntaxAllowedAsLiteralValue = value;
@@ -678,9 +680,9 @@
trimDirectiveWhitespaces = false;
else {
if (pagedir)
- err.jspError(n,
"jsp.error.page.invalid.trimdirectivewhitespaces");
+ err.jspError(n.getStart(),
MESSAGES.invalidPageDirectiveTrimDirectiveWhitespaces());
else
- err.jspError(n,
"jsp.error.tag.invalid.trimdirectivewhitespaces");
+ err.jspError(n.getStart(),
MESSAGES.invalidTagDirectiveTrimDirectiveWhitespaces());
}
trimDirectiveWhitespacesValue = value;
Modified: trunk/src/main/java/org/apache/jasper/compiler/Parser.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/Parser.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/Parser.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -16,6 +16,8 @@
*/
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.CharArrayWriter;
import java.io.FileNotFoundException;
import java.net.URL;
@@ -182,20 +184,19 @@
String prefix = qName.substring(0, index);
uri = pageInfo.getURI(prefix);
if (uri == null) {
- err.jspError(reader.mark(),
- "jsp.error.attribute.invalidPrefix", prefix);
+ err.jspError(reader.mark(), MESSAGES.invalidAttributePrefix(prefix));
}
localName = qName.substring(index + 1);
}
reader.skipSpaces();
if (!reader.matches("="))
- err.jspError(reader.mark(), "jsp.error.attribute.noequal");
+ err.jspError(reader.mark(), MESSAGES.missingEqual());
reader.skipSpaces();
char quote = (char) reader.nextChar();
if (quote != '\'' && quote != '"')
- err.jspError(reader.mark(), "jsp.error.attribute.noquote");
+ err.jspError(reader.mark(), MESSAGES.missingQuote());
String watchString = "";
if (reader.matches("<%="))
@@ -237,7 +238,7 @@
Mark start = reader.mark();
Mark stop = reader.skipUntilIgnoreEsc(watch);
if (stop == null) {
- err.jspError(start, "jsp.error.attribute.unterminated", watch);
+ err.jspError(start, MESSAGES.unterminatedAttribute(watch));
}
String ret = null;
@@ -295,9 +296,9 @@
try {
parserController.parse(file, parent, jarFileUrl);
} catch (FileNotFoundException ex) {
- err.jspError(start, "jsp.error.file.not.found", file);
+ err.jspError(start, MESSAGES.fileNotFound(file));
} catch (Exception ex) {
- err.jspError(parent, "jsp.error.include.exception", file, ex);
+ err.jspError(parent.getStart(), MESSAGES.errorIncluding(file), ex);
}
}
@@ -365,15 +366,13 @@
if (prefix != null) {
Mark prevMark = pageInfo.getNonCustomTagPrefix(prefix);
if (prevMark != null) {
- err.jspError(reader.mark(), "jsp.error.prefix.use_before_dcl",
- prefix, prevMark.getFile(), ""
- + prevMark.getLineNumber());
+ err.jspError(reader.mark(), MESSAGES.prefixAlreadyInUse
+ (prefix, prevMark.getFile(), prevMark.getLineNumber()));
}
if (uri != null) {
String uriPrev = pageInfo.getURI(prefix);
if (uriPrev != null && !uriPrev.equals(uri)) {
- err.jspError(reader.mark(), "jsp.error.prefix.refined",
- prefix, uri, uriPrev);
+ err.jspError(reader.mark(), MESSAGES.prefixRedefinition(prefix, uri,
uriPrev));
}
if (pageInfo.getTaglib(uri) == null) {
TagLibraryInfoImpl impl = null;
@@ -431,8 +430,7 @@
if (reader.matches("page")) {
directive = "<%@ page";
if (isTagFile) {
- err.jspError(reader.mark(), "jsp.error.directive.istagfile",
- directive);
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInTagFile(directive));
}
parsePageDirective(parent);
} else if (reader.matches("include")) {
@@ -449,31 +447,28 @@
} else if (reader.matches("tag")) {
directive = "<%@ tag";
if (!isTagFile) {
- err.jspError(reader.mark(),
"jsp.error.directive.isnottagfile",
- directive);
+ err.jspError(reader.mark(), MESSAGES.invalidDirectiveInPage(directive));
}
parseTagDirective(parent);
} else if (reader.matches("attribute")) {
directive = "<%@ attribute";
if (!isTagFile) {
- err.jspError(reader.mark(),
"jsp.error.directive.isnottagfile",
- directive);
+ err.jspError(reader.mark(), MESSAGES.invalidDirectiveInPage(directive));
}
parseAttributeDirective(parent);
} else if (reader.matches("variable")) {
directive = "<%@ variable";
if (!isTagFile) {
- err.jspError(reader.mark(),
"jsp.error.directive.isnottagfile",
- directive);
+ err.jspError(reader.mark(), MESSAGES.invalidDirectiveInPage(directive));
}
parseVariableDirective(parent);
} else {
- err.jspError(reader.mark(), "jsp.error.invalid.directive");
+ err.jspError(reader.mark(), MESSAGES.invalidDirective());
}
reader.skipSpaces();
if (!reader.matches("%>")) {
- err.jspError(start, "jsp.error.unterminated", directive);
+ err.jspError(start, MESSAGES.unterminatedTag(directive));
}
}
@@ -497,8 +492,7 @@
if (reader.matches("page")) {
eTag = "jsp:directive.page";
if (isTagFile) {
- err.jspError(reader.mark(), "jsp.error.directive.istagfile",
- "<" + eTag);
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInTagFile("<" + eTag));
}
parsePageDirective(parent);
} else if (reader.matches("include")) {
@@ -507,36 +501,33 @@
} else if (reader.matches("tag")) {
eTag = "jsp:directive.tag";
if (!isTagFile) {
- err.jspError(reader.mark(),
"jsp.error.directive.isnottagfile",
- "<" + eTag);
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInPage("<" + eTag));
}
parseTagDirective(parent);
} else if (reader.matches("attribute")) {
eTag = "jsp:directive.attribute";
if (!isTagFile) {
- err.jspError(reader.mark(),
"jsp.error.directive.isnottagfile",
- "<" + eTag);
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInPage("<" + eTag));
}
parseAttributeDirective(parent);
} else if (reader.matches("variable")) {
eTag = "jsp:directive.variable";
if (!isTagFile) {
- err.jspError(reader.mark(),
"jsp.error.directive.isnottagfile",
- "<" + eTag);
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInPage("<" + eTag));
}
parseVariableDirective(parent);
} else {
- err.jspError(reader.mark(), "jsp.error.invalid.directive");
+ err.jspError(reader.mark(), MESSAGES.invalidDirective());
}
reader.skipSpaces();
if (reader.matches(">")) {
reader.skipSpaces();
if (!reader.matchesETag(eTag)) {
- err.jspError(start, "jsp.error.unterminated",
"<" + eTag);
+ err.jspError(start, MESSAGES.unterminatedTag("<" +
eTag));
}
} else if (!reader.matches("/>")) {
- err.jspError(start, "jsp.error.unterminated", "<"
+ eTag);
+ err.jspError(start, MESSAGES.unterminatedTag("<" + eTag));
}
}
@@ -587,7 +578,7 @@
start = reader.mark();
Mark stop = reader.skipUntil("--%>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"<%--");
+ err.jspError(start, MESSAGES.unterminatedTag("<%--"));
}
new Node.Comment(reader.getText(start, stop), start, parent);
@@ -600,7 +591,7 @@
start = reader.mark();
Mark stop = reader.skipUntil("%>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"<%!");
+ err.jspError(start, MESSAGES.unterminatedTag("<%!"));
}
new Node.Declaration(parseScriptText(reader.getText(start, stop)),
@@ -617,8 +608,7 @@
reader.skipSpaces();
if (!reader.matches("/>")) {
if (!reader.matches(">")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:declaration>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:declaration>"));
}
Mark stop;
String text;
@@ -626,8 +616,7 @@
start = reader.mark();
stop = reader.skipUntil("<");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:declaration>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:declaration>"));
}
text = parseScriptText(reader.getText(start, stop));
new Node.Declaration(text, start, parent);
@@ -635,7 +624,7 @@
start = reader.mark();
stop = reader.skipUntil("]]>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"CDATA");
+ err.jspError(start,
MESSAGES.unterminatedTag("CDATA"));
}
text = parseScriptText(reader.getText(start, stop));
new Node.Declaration(text, start, parent);
@@ -645,8 +634,7 @@
}
if (!reader.matchesETagWithoutLessThan("jsp:declaration")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:declaration>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:declaration>"));
}
}
}
@@ -658,7 +646,7 @@
start = reader.mark();
Mark stop = reader.skipUntil("%>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"<%=");
+ err.jspError(start, MESSAGES.unterminatedTag("<%="));
}
new Node.Expression(parseScriptText(reader.getText(start, stop)),
@@ -673,8 +661,7 @@
reader.skipSpaces();
if (!reader.matches("/>")) {
if (!reader.matches(">")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:expression>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:expression>"));
}
Mark stop;
String text;
@@ -682,8 +669,7 @@
start = reader.mark();
stop = reader.skipUntil("<");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:expression>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:expression>"));
}
text = parseScriptText(reader.getText(start, stop));
new Node.Expression(text, start, parent);
@@ -691,7 +677,7 @@
start = reader.mark();
stop = reader.skipUntil("]]>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"CDATA");
+ err.jspError(start,
MESSAGES.unterminatedTag("CDATA"));
}
text = parseScriptText(reader.getText(start, stop));
new Node.Expression(text, start, parent);
@@ -700,8 +686,7 @@
}
}
if (!reader.matchesETagWithoutLessThan("jsp:expression")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:expression>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:expression>"));
}
}
}
@@ -725,7 +710,7 @@
currentChar = reader.nextChar();
}
if (currentChar == -1)
- err.jspError(start, "jsp.error.unterminated", type +
"{");
+ err.jspError(start, MESSAGES.unterminatedTag(type + "{"));
if (currentChar == '"' && !singleQuoted)
doubleQuoted = !doubleQuoted;
if (currentChar == '\'' && !doubleQuoted)
@@ -742,7 +727,7 @@
start = reader.mark();
Mark stop = reader.skipUntil("%>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"<%");
+ err.jspError(start, MESSAGES.unterminatedTag("<%"));
}
new Node.Scriptlet(parseScriptText(reader.getText(start, stop)), start,
@@ -757,8 +742,7 @@
reader.skipSpaces();
if (!reader.matches("/>")) {
if (!reader.matches(">")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:scriptlet>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:scriptlet>"));
}
Mark stop;
String text;
@@ -766,8 +750,7 @@
start = reader.mark();
stop = reader.skipUntil("<");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:scriptlet>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:scriptlet>"));
}
text = parseScriptText(reader.getText(start, stop));
new Node.Scriptlet(text, start, parent);
@@ -775,7 +758,7 @@
start = reader.mark();
stop = reader.skipUntil("]]>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"CDATA");
+ err.jspError(start,
MESSAGES.unterminatedTag("CDATA"));
}
text = parseScriptText(reader.getText(start, stop));
new Node.Scriptlet(text, start, parent);
@@ -785,8 +768,7 @@
}
if (!reader.matchesETagWithoutLessThan("jsp:scriptlet")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:scriptlet>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:scriptlet>"));
}
}
}
@@ -796,7 +778,7 @@
*/
private void parseParam(Node parent) throws JasperException {
if (!reader.matches("<jsp:param")) {
- err.jspError(reader.mark(), "jsp.error.paramexpected");
+ err.jspError(reader.mark(), MESSAGES.missingParamAction());
}
Attributes attrs = parseAttributes();
reader.skipSpaces();
@@ -909,14 +891,13 @@
if (!reader.matchesETag(tag)) {
// Body not allowed
err.jspError(reader.mark(),
- "jsp.error.jspbody.emptybody.only",
"<" + tag);
+ MESSAGES.invalidEmptyBodyTag("<" + tag));
}
} else {
- err.jspError(reader.mark(),
"jsp.error.jspbody.emptybody.only",
- "<" + tag);
+ err.jspError(reader.mark(),
MESSAGES.invalidEmptyBodyTag("<" + tag));
}
} else {
- err.jspError(reader.mark(), "jsp.error.unterminated",
"<" + tag);
+ err.jspError(reader.mark(), MESSAGES.unterminatedTag("<" +
tag));
}
}
@@ -963,7 +944,7 @@
}
if (!reader.matches(">")) {
- err.jspError(reader.mark(), "jsp.error.unterminated",
"<" + tag);
+ err.jspError(reader.mark(), MESSAGES.unterminatedTag("<" +
tag));
}
if (reader.matchesETag(tag)) {
@@ -1003,16 +984,14 @@
parseJspBody(parent, bodyType);
reader.skipSpaces();
if (!reader.matchesETag(tag)) {
- err.jspError(reader.mark(), "jsp.error.unterminated",
"<"
- + tag);
+ err.jspError(reader.mark(), MESSAGES.unterminatedTag("<"
+ tag));
}
result = true;
} else if (result && !reader.matchesETag(tag)) {
// If we have <jsp:attribute> but something other than
// <jsp:body> or the end tag, translation error.
- err.jspError(reader.mark(), "jsp.error.jspbody.required",
"<"
- + tag);
+ err.jspError(reader.mark(), MESSAGES.invalidTagBody("<" +
tag));
}
return result;
@@ -1092,14 +1071,12 @@
parseForward(parent);
} else if (reader.matches(INVOKE_ACTION)) {
if (!isTagFile) {
- err.jspError(reader.mark(), "jsp.error.action.isnottagfile",
- "<jsp:invoke");
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInPage("<jsp:invoke"));
}
parseInvoke(parent);
} else if (reader.matches(DOBODY_ACTION)) {
if (!isTagFile) {
- err.jspError(reader.mark(), "jsp.error.action.isnottagfile",
- "<jsp:doBody");
+ err.jspError(reader.mark(),
MESSAGES.invalidDirectiveInPage("<jsp:doBody"));
}
parseDoBody(parent);
} else if (reader.matches(GET_PROPERTY_ACTION)) {
@@ -1113,19 +1090,19 @@
} else if (reader.matches(ELEMENT_ACTION)) {
parseElement(parent);
} else if (reader.matches(ATTRIBUTE_ACTION)) {
- err.jspError(start, "jsp.error.namedAttribute.invalidUse");
+ err.jspError(start, MESSAGES.invalidJspAttribute());
} else if (reader.matches(BODY_ACTION)) {
- err.jspError(start, "jsp.error.jspbody.invalidUse");
+ err.jspError(start, MESSAGES.invalidJspBody());
} else if (reader.matches(FALLBACK_ACTION)) {
- err.jspError(start, "jsp.error.fallback.invalidUse");
+ err.jspError(start, MESSAGES.invalidJspFallback());
} else if (reader.matches(PARAMS_ACTION)) {
- err.jspError(start, "jsp.error.params.invalidUse");
+ err.jspError(start, MESSAGES.invalidJspParams());
} else if (reader.matches(PARAM_ACTION)) {
- err.jspError(start, "jsp.error.param.invalidUse");
+ err.jspError(start, MESSAGES.invalidJspParam());
} else if (reader.matches(OUTPUT_ACTION)) {
- err.jspError(start, "jsp.error.jspoutput.invalidUse");
+ err.jspError(start, MESSAGES.invalidJspOutput());
} else {
- err.jspError(start, "jsp.error.badStandardAction");
+ err.jspError(start, MESSAGES.invalidStandardAction());
}
}
@@ -1173,7 +1150,7 @@
String uri = pageInfo.getURI(prefix);
if (uri == null) {
if (pageInfo.isErrorOnUndeclaredNamespace()) {
- err.jspError(start, "jsp.error.bad_tag", shortTagName,
prefix);
+ err.jspError(start, MESSAGES.unknownTagPrefix(shortTagName, prefix));
}
reader.reset(start);
// Remember the prefix for later error checking
@@ -1185,7 +1162,7 @@
TagInfo tagInfo = tagLibInfo.getTag(shortTagName);
TagFileInfo tagFileInfo = tagLibInfo.getTagFile(shortTagName);
if (tagInfo == null && tagFileInfo == null) {
- err.jspError(start, "jsp.error.bad_tag", shortTagName, prefix);
+ err.jspError(start, MESSAGES.unknownTagPrefix(shortTagName, prefix));
}
Class tagHandlerClass = null;
if (tagInfo != null) {
@@ -1196,8 +1173,7 @@
tagHandlerClass = ctxt.getClassLoader().loadClass(
handlerClassName);
} catch (Exception e) {
- err.jspError(start, "jsp.error.loadclass.taghandler",
- handlerClassName, tagName);
+ err.jspError(start, MESSAGES.errorLoadingTagHandler(handlerClassName,
tagName));
}
}
@@ -1311,8 +1287,7 @@
reader.skipSpaces();
if (!reader.matches("/>")) {
if (!reader.matches(">")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:text>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:text>"));
}
CharArrayWriter ttext = new CharArrayWriter();
while (reader.hasMoreInput()) {
@@ -1325,7 +1300,7 @@
start = reader.mark();
Mark stop = reader.skipUntil("]]>");
if (stop == null) {
- err.jspError(start, "jsp.error.unterminated",
"CDATA");
+ err.jspError(start,
MESSAGES.unterminatedTag("CDATA"));
}
String text = reader.getText(start, stop);
ttext.write(text, 0, text.length());
@@ -1366,10 +1341,9 @@
new Node.TemplateText(ttext.toString(), start, parent);
if (!reader.hasMoreInput()) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:text>");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:text>"));
} else if (!reader.matchesETagWithoutLessThan("jsp:text")) {
- err.jspError(start, "jsp.error.jsptext.badcontent");
+ err.jspError(start, MESSAGES.badContent());
}
}
}
@@ -1446,17 +1420,17 @@
} else if (reader.matches("<jsp:directive.")) {
parseXMLDirective(parent);
} else if (reader.matches("<%!")) {
- err.jspError(reader.mark(), "jsp.error.no.scriptlets");
+ err.jspError(reader.mark(), MESSAGES.invalidScriptingElement());
} else if (reader.matches("<jsp:declaration")) {
- err.jspError(reader.mark(), "jsp.error.no.scriptlets");
+ err.jspError(reader.mark(), MESSAGES.invalidScriptingElement());
} else if (reader.matches("<%=")) {
- err.jspError(reader.mark(), "jsp.error.no.scriptlets");
+ err.jspError(reader.mark(), MESSAGES.invalidScriptingElement());
} else if (reader.matches("<jsp:expression")) {
- err.jspError(reader.mark(), "jsp.error.no.scriptlets");
+ err.jspError(reader.mark(), MESSAGES.invalidScriptingElement());
} else if (reader.matches("<%")) {
- err.jspError(reader.mark(), "jsp.error.no.scriptlets");
+ err.jspError(reader.mark(), MESSAGES.invalidScriptingElement());
} else if (reader.matches("<jsp:scriptlet")) {
- err.jspError(reader.mark(), "jsp.error.no.scriptlets");
+ err.jspError(reader.mark(), MESSAGES.invalidScriptingElement());
} else if (reader.matches("<jsp:text")) {
parseXMLTemplateText(parent);
} else if (!pageInfo.isELIgnored() && reader.matches("${")) {
@@ -1492,40 +1466,29 @@
} else if (reader.matches("<jsp:directive.")) {
parseXMLDirective(parent);
} else if (reader.matches("<%!")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Declarations");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<%!"));
} else if (reader.matches("<jsp:declaration")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Declarations");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<jsp:declaration"));
} else if (reader.matches("<%=")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Expressions");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<%="));
} else if (reader.matches("<jsp:expression")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Expressions");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<jsp:expression"));
} else if (reader.matches("<%")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Scriptlets");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<%"));
} else if (reader.matches("<jsp:scriptlet")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Scriptlets");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<jsp:scriptlet"));
} else if (reader.matches("<jsp:text")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "<jsp:text");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<jsp:text"));
} else if (!pageInfo.isELIgnored() && reader.matches("${")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Expression language");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("${"));
} else if (!pageInfo.isELIgnored()
&& !pageInfo.isDeferredSyntaxAllowedAsLiteral()
&& reader.matches("#{")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Expression language");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("#{"));
} else if (reader.matches("<jsp:")) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Standard actions");
+ err.jspError(reader.mark(),
MESSAGES.invalidTemplateTextBody("<jsp:"));
} else if (parseCustomTag(parent)) {
- err.jspError(reader.mark(), "jsp.error.not.in.template",
- "Custom actions");
+ err.jspError(reader.mark(), MESSAGES.invalidTagInTemplateTextBody());
} else {
checkUnbalancedEndTag();
parseTemplateText(parent);
@@ -1543,7 +1506,7 @@
// Check for unbalanced standard actions
if (reader.matches("jsp:")) {
- err.jspError(start, "jsp.error.unbalanced.endtag",
"jsp:");
+ err.jspError(start, MESSAGES.unbalancedEndTag("jsp:"));
}
// Check for unbalanced custom actions
@@ -1554,7 +1517,7 @@
return;
}
- err.jspError(start, "jsp.error.unbalanced.endtag", tagName);
+ err.jspError(start, MESSAGES.unbalancedEndTag(tagName));
}
/**
@@ -1565,7 +1528,7 @@
Mark bodyStart = reader.mark();
Mark bodyEnd = reader.skipUntilETag(tag);
if (bodyEnd == null) {
- err.jspError(start, "jsp.error.unterminated", "<"
+ tag);
+ err.jspError(start, MESSAGES.unterminatedTag("<" + tag));
}
new Node.TemplateText(reader.getText(bodyStart, bodyEnd), bodyStart,
parent);
@@ -1582,7 +1545,7 @@
reader.skipSpaces();
if (!reader.matches("/>")) {
if (!reader.matches(">")) {
- err.jspError(start, "jsp.error.unterminated",
"<jsp:body");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:body"));
}
parseBody(bodyNode, "jsp:body", bodyType);
}
@@ -1599,16 +1562,14 @@
parseTagDependentBody(parent, tag);
} else if (bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_EMPTY)) {
if (!reader.matchesETag(tag)) {
- err.jspError(start, "jasper.error.emptybodycontent.nonempty",
- tag);
+ err.jspError(start, MESSAGES.invalidEmptyTagSubelements(tag));
}
} else if (bodyType == JAVAX_BODY_CONTENT_PLUGIN) {
// (note the == since we won't recognize JAVAX_*
// from outside this module).
parsePluginTags(parent);
if (!reader.matchesETag(tag)) {
- err.jspError(reader.mark(), "jsp.error.unterminated",
"<"
- + tag);
+ err.jspError(reader.mark(), MESSAGES.unterminatedTag("<"
+ tag));
}
} else if (bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_JSP)
|| bodyType.equalsIgnoreCase(TagInfo.BODY_CONTENT_SCRIPTLESS)
@@ -1622,10 +1583,9 @@
// Check for nested jsp:body or jsp:attribute
if (tag.equals("jsp:body") ||
tag.equals("jsp:attribute")) {
if (reader.matches("<jsp:attribute")) {
- err.jspError(reader.mark(),
- "jsp.error.nested.jspattribute");
+ err.jspError(reader.mark(),
MESSAGES.invalidJspAttributeNesting());
} else if (reader.matches("<jsp:body")) {
- err.jspError(reader.mark(),
"jsp.error.nested.jspbody");
+ err.jspError(reader.mark(), MESSAGES.invalidJspBodyNesting());
}
}
@@ -1643,9 +1603,9 @@
parseElementsTemplateText(parent);
}
}
- err.jspError(start, "jsp.error.unterminated", "<"
+ tag);
+ err.jspError(start, MESSAGES.unterminatedTag("<" + tag));
} else {
- err.jspError(start, "jasper.error.bad.bodycontent.type");
+ err.jspError(start, MESSAGES.invalidBodyContentType());
}
}
@@ -1662,8 +1622,7 @@
reader.skipSpaces();
if (!reader.matches("/>")) {
if (!reader.matches(">")) {
- err.jspError(start, "jsp.error.unterminated",
- "<jsp:attribute");
+ err.jspError(start,
MESSAGES.unterminatedTag("<jsp:attribute"));
}
if (namedAttributeNode.isTrim()) {
reader.skipSpaces();
Modified: trunk/src/main/java/org/apache/jasper/compiler/ParserController.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/ParserController.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/ParserController.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.FileNotFoundException;
import java.io.IOException;
import java.io.InputStreamReader;
@@ -226,8 +228,7 @@
if (jspConfigPageEnc != null && !jspConfigPageEnc.equals(sourceEnc)
&& (!jspConfigPageEnc.startsWith("UTF-16")
|| !sourceEnc.startsWith("UTF-16"))) {
- err.jspError("jsp.error.prolog_config_encoding_mismatch",
- sourceEnc, jspConfigPageEnc);
+ err.jspError(MESSAGES.encodingConflict(sourceEnc, jspConfigPageEnc));
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/ScriptingVariabler.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/ScriptingVariabler.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/ScriptingVariabler.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,8 +17,16 @@
package org.apache.jasper.compiler;
-import java.util.*;
-import javax.servlet.jsp.tagext.*;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
+import java.util.ArrayList;
+import java.util.HashMap;
+import java.util.List;
+import java.util.Map;
+
+import javax.servlet.jsp.tagext.TagVariableInfo;
+import javax.servlet.jsp.tagext.VariableInfo;
+
import org.apache.jasper.JasperException;
/**
@@ -122,8 +130,8 @@
varName = n.getTagData().getAttributeString(
tagVarInfos[i].getNameFromAttribute());
if (varName == null) {
- err.jspError(n,
"jsp.error.scripting.variable.missing_name",
- tagVarInfos[i].getNameFromAttribute());
+ err.jspError(n.getStart(),
MESSAGES.cannotFindVariableNameFromAttribute
+ (tagVarInfos[i].getNameFromAttribute()));
}
}
Modified: trunk/src/main/java/org/apache/jasper/compiler/TagFileProcessor.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/TagFileProcessor.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/TagFileProcessor.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.FileNotFoundException;
import java.io.IOException;
import java.net.MalformedURLException;
@@ -147,7 +149,7 @@
public void visit(Node.TagDirective n) throws JasperException {
- JspUtil.checkAttributes("Tag directive", n, tagDirectiveAttrs,
err);
+ JspUtil.checkAttributes(TagConstants.TAG_DIRECTIVE_ACTION, n,
tagDirectiveAttrs, err);
bodycontent = checkConflict(n, bodycontent, "body-content");
if (bodycontent != null
@@ -157,8 +159,7 @@
.equalsIgnoreCase(TagInfo.BODY_CONTENT_TAG_DEPENDENT)
&& !bodycontent
.equalsIgnoreCase(TagInfo.BODY_CONTENT_SCRIPTLESS)) {
- err.jspError(n, "jsp.error.tagdirective.badbodycontent",
- bodycontent);
+ err.jspError(n.getStart(),
MESSAGES.invalidBodyContentInTagDirective(bodycontent));
}
dynamicAttrsMapName = checkConflict(n, dynamicAttrsMapName,
"dynamic-attributes");
@@ -179,8 +180,8 @@
String attrValue = n.getAttributeValue(attr);
if (attrValue != null) {
if (oldAttrValue != null && !oldAttrValue.equals(attrValue)) {
- err.jspError(n, "jsp.error.tag.conflict.attr", attr,
- oldAttrValue, attrValue);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingTagDirectiveAttributeValues(attr,
+ oldAttrValue, attrValue));
}
result = attrValue;
}
@@ -189,7 +190,7 @@
public void visit(Node.AttributeDirective n) throws JasperException {
- JspUtil.checkAttributes("Attribute directive", n,
+ JspUtil.checkAttributes(TagConstants.ATTRIBUTE_DIRECTIVE_ACTION, n,
attributeDirectiveAttrs, err);
// JSP 2.1 Table JSP.8-3
@@ -204,7 +205,7 @@
String deferredValueType =
n.getAttributeValue("deferredValueType");
if (deferredValueType != null) {
if (deferredValueSpecified && !deferredValue) {
- err.jspError(n,
"jsp.error.deferredvaluetypewithoutdeferredvalue");
+ err.jspError(n.getStart(),
MESSAGES.cannotUseValueTypeWithoutDeferredValue());
} else {
deferredValue = true;
}
@@ -227,7 +228,7 @@
.getAttributeValue("deferredMethodSignature");
if (deferredMethodSignature != null) {
if (deferredMethodSpecified && !deferredMethod) {
- err.jspError(n,
"jsp.error.deferredmethodsignaturewithoutdeferredmethod");
+ err.jspError(n.getStart(),
MESSAGES.cannotUseMethodSignatureWithoutDeferredMethod());
} else {
deferredMethod = true;
}
@@ -236,7 +237,7 @@
}
if (deferredMethod && deferredValue) {
- err.jspError(n, "jsp.error.deferredmethodandvalue");
+ err.jspError(n.getStart(),
MESSAGES.cannotUseBothDeferredValueAndMethod());
}
String attrName = n.getAttributeValue("name");
@@ -254,13 +255,13 @@
// type is fixed to "JspFragment" and a translation error
// must occur if specified.
if (type != null) {
- err.jspError(n, "jsp.error.fragmentwithtype");
+ err.jspError(n.getStart(), MESSAGES.cannotUseFragmentWithType());
}
// rtexprvalue is fixed to "true" and a translation error
// must occur if specified.
rtexprvalue = true;
if (rtexprvalueString != null) {
- err.jspError(n, "jsp.error.frgmentwithrtexprvalue");
+ err.jspError(n.getStart(),
MESSAGES.cannotUseFragmentWithRtexprValue());
}
} else {
if (type == null)
@@ -276,7 +277,7 @@
if (("2.0".equals(tagLibInfo.getRequiredVersion()) ||
("1.2".equals(tagLibInfo.getRequiredVersion())))
&& (deferredMethodSpecified || deferredMethod
|| deferredValueSpecified || deferredValue)) {
- err.jspError("jsp.error.invalid.version", path);
+ err.jspError(MESSAGES.invalidTagFileJspVersion(path));
}
TagAttributeInfo tagAttributeInfo = new TagAttributeInfo(attrName,
@@ -288,24 +289,24 @@
public void visit(Node.VariableDirective n) throws JasperException {
- JspUtil.checkAttributes("Variable directive", n,
+ JspUtil.checkAttributes(TagConstants.VARIABLE_DIRECTIVE_ACTION, n,
variableDirectiveAttrs, err);
String nameGiven = n.getAttributeValue("name-given");
String nameFromAttribute = n
.getAttributeValue("name-from-attribute");
if (nameGiven == null && nameFromAttribute == null) {
- err.jspError("jsp.error.variable.either.name");
+ err.jspError(MESSAGES.mustSpecifyVariableDirectiveEitherName());
}
if (nameGiven != null && nameFromAttribute != null) {
- err.jspError("jsp.error.variable.both.name");
+ err.jspError(MESSAGES.mustNotSpecifyVariableDirectiveBothName());
}
String alias = n.getAttributeValue("alias");
if (nameFromAttribute != null && alias == null
|| nameFromAttribute == null && alias != null) {
- err.jspError("jsp.error.variable.alias");
+ err.jspError(MESSAGES.mustNotSpecifyVariableDirectiveBothOrNoneName());
}
String className = n.getAttributeValue("variable-class");
@@ -450,8 +451,8 @@
if (nameEntry != null) {
if (type != TAG_DYNAMIC || nameEntry.getType() != TAG_DYNAMIC) {
int line = nameEntry.getNode().getStart().getLineNumber();
- err.jspError(n, "jsp.error.tagfile.nameNotUnique", type,
- nameEntry.getType(), Integer.toString(line));
+ err.jspError(n.getStart(), MESSAGES.invalidDuplicateNames(type,
+ nameEntry.getType(), line));
}
} else {
table.put(name, new NameEntry(type, n, attr));
@@ -471,18 +472,16 @@
.get(nameFrom);
Node nameFromNode = nameFromEntry.getNode();
if (nameEntry == null) {
- err.jspError(nameFromNode,
- "jsp.error.tagfile.nameFrom.noAttribute",
nameFrom);
+ err.jspError(nameFromNode.getStart(),
+ MESSAGES.cannotFindAttribute(nameFrom));
} else {
Node node = nameEntry.getNode();
TagAttributeInfo tagAttr = nameEntry.getTagAttributeInfo();
if (!"java.lang.String".equals(tagAttr.getTypeName())
|| !tagAttr.isRequired()
|| tagAttr.canBeRequestTime()) {
- err.jspError(nameFromNode,
- "jsp.error.tagfile.nameFrom.badAttribute",
- nameFrom, Integer.toString(node.getStart()
- .getLineNumber()));
+ err.jspError(nameFromNode.getStart(),
MESSAGES.invalidAttributeFound(node.getStart()
+ .getLineNumber(), nameFrom));
}
}
}
@@ -546,9 +545,9 @@
try {
page = pc.parseTagFileDirectives(path, tagFileJarUrl);
} catch (FileNotFoundException e) {
- err.jspError("jsp.error.file.not.found", path);
+ err.jspError(MESSAGES.fileNotFound(path));
} catch (IOException e) {
- err.jspError("jsp.error.file.not.found", path);
+ err.jspError(MESSAGES.fileNotFound(path));
}
TagFileDirectiveVisitor tagFileVisitor = new TagFileDirectiveVisitor(pc
Modified: trunk/src/main/java/org/apache/jasper/compiler/TagLibraryInfoImpl.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/TagLibraryInfoImpl.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/TagLibraryInfoImpl.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -46,6 +46,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.PrintWriter;
import java.io.StringWriter;
import java.net.MalformedURLException;
@@ -71,7 +73,6 @@
import org.apache.catalina.util.RequestUtil;
import org.apache.jasper.JasperException;
import org.apache.jasper.JspCompilationContext;
-import org.jboss.logging.Logger;
/**
* Implementation of the TagLibraryInfo class from the JSP spec.
@@ -91,9 +92,6 @@
public static final int ROOT_REL_URI = 1;
public static final int NOROOT_REL_URI = 2;
- // Logger
- private Logger log = Logger.getLogger(TagLibraryInfoImpl.class);
-
private JspCompilationContext ctxt;
private PageInfo pi;
@@ -157,7 +155,7 @@
URL jarFileUrl = null;
if (location == null) {
- err.jspError("jsp.error.file.not.found", uriIn);
+ err.jspError(MESSAGES.fileNotFound(uriIn));
}
if (location[0] != null && location[0].endsWith(".jar")) {
try {
@@ -166,7 +164,7 @@
jarFileUrl = new URL("jar:" + jarUrl + "!/");
}
} catch (MalformedURLException ex) {
- err.jspError("jsp.error.file.not.found", uriIn);
+ err.jspError(MESSAGES.fileNotFound(uriIn));
}
}
@@ -174,7 +172,7 @@
((HashMap<String, org.apache.catalina.deploy.jsp.TagLibraryInfo>)
ctxt.getServletContext().getAttribute(Globals.JSP_TAG_LIBRARIES)).get(uri);
if (tagLibraryInfo == null) {
- err.jspError("jsp.error.file.not.found", uriIn);
+ err.jspError(MESSAGES.fileNotFound(uriIn));
}
ArrayList<TagInfo> tagInfos = new ArrayList<TagInfo>();
@@ -203,19 +201,17 @@
for (int i = 0; i < functionInfosArray.length; i++) {
FunctionInfo functionInfo = createFunctionInfo(functionInfosArray[i]);
if (functionInfos.containsKey(functionInfo.getName())) {
- err.jspError("jsp.error.tld.fn.duplicate.name",
functionInfo.getName(),
- uri);
+
err.jspError(MESSAGES.duplicateTagLibraryFunctionName(functionInfo.getName(),
+ uri));
}
functionInfos.put(functionInfo.getName(), functionInfo);
}
if (tlibversion == null) {
- err.jspError("jsp.error.tld.mandatory.element.missing",
- "tlib-version");
+
err.jspError(MESSAGES.missingRequiredTagLibraryElement("tlib-version", uri));
}
if (jspversion == null) {
- err.jspError("jsp.error.tld.mandatory.element.missing",
- "jsp-version");
+
err.jspError(MESSAGES.missingRequiredTagLibraryElement("jsp-version", uri));
}
this.tags = tagInfos.toArray(new TagInfo[0]);
@@ -236,8 +232,7 @@
int uriType = uriType(uri);
if (uriType == ABS_URI) {
- err.jspError("jsp.error.taglibDirective.absUriCannotBeResolved",
- uri);
+ err.jspError(MESSAGES.unresolvableAbsoluteUri(uri));
} else if (uriType == NOROOT_REL_URI) {
uri = ctxt.resolveRelativeUri(uri);
if (uri != null) {
@@ -252,11 +247,10 @@
try {
url = ctxt.getResource(location[0]);
} catch (Exception ex) {
- err.jspError("jsp.error.tld.unable_to_get_jar", location[0],
ex
- .toString());
+ err.jspError(MESSAGES.errorAccessingJar(location[0]), ex);
}
if (url == null) {
- err.jspError("jsp.error.tld.missing_jar", location[0]);
+ err.jspError(MESSAGES.missingJar(location[0]));
}
location[0] = url.toString();
location[1] = "META-INF/taglib.tld";
@@ -297,8 +291,7 @@
Class teiClass = ctxt.getClassLoader().loadClass(teiClassName);
tei = (TagExtraInfo) teiClass.newInstance();
} catch (Exception e) {
- err.jspError("jsp.error.teiclass.instantiation", teiClassName,
- e);
+ err.jspError(MESSAGES.errorLoadingTagExtraInfo(teiClassName), e);
}
}
@@ -416,7 +409,7 @@
// it has been removed
ctxt.setTagFileJarUrl(path, jarFileUrl);
} else if (!path.startsWith("/WEB-INF/tags")) {
- err.jspError("jsp.error.tagfile.illegalPath", path);
+ err.jspError(MESSAGES.invalidTagFileDirectory(path));
}
TagInfo tagInfo = TagFileProcessor.parseTagFileDirectives(
parserController, name, path, jarFileUrl, this);
@@ -458,8 +451,7 @@
.loadClass(validatorClass);
tlv = (TagLibraryValidator) tlvClass.newInstance();
} catch (Exception e) {
- err.jspError("jsp.error.tlvclass.instantiation",
- validatorClass, e);
+ err.jspError(MESSAGES.errorLoadingTagLibraryValidator(validatorClass),
e);
}
}
if (tlv != null) {
Modified: trunk/src/main/java/org/apache/jasper/compiler/TagPluginManager.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/TagPluginManager.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/TagPluginManager.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.InputStream;
import java.util.HashMap;
@@ -89,8 +91,8 @@
}
if (!TAG_PLUGINS_ROOT_ELEM.equals(reader.getLocalName())) {
- err.jspError("jsp.error.plugin.wrongRootElement",
TAG_PLUGINS_XML,
- TAG_PLUGINS_ROOT_ELEM);
+ err.jspError(MESSAGES.wrongRootElement(TAG_PLUGINS_XML,
+ TAG_PLUGINS_ROOT_ELEM));
}
tagPlugins = new HashMap<String, TagPlugin>();
@@ -106,11 +108,11 @@
} else if ("plugin-class".equals(childClementName)) {
pluginClassName = reader.getElementText().trim();
} else {
- err.jspError("jsp.error.invalid.tagplugin",
TAG_PLUGINS_XML);
+ err.jspError(MESSAGES.invalidTagPlugin(TAG_PLUGINS_XML));
}
}
if (tagClassName == null || pluginClassName == null) {
- err.jspError("jsp.error.invalid.tagplugin",
TAG_PLUGINS_XML);
+ err.jspError(MESSAGES.invalidTagPlugin(TAG_PLUGINS_XML));
}
TagPlugin tagPlugin = null;
try {
@@ -126,11 +128,11 @@
} else {
// All other elements are invalid
- err.jspError("jsp.error.invalid.tagplugin",
TAG_PLUGINS_XML);
+ err.jspError(MESSAGES.invalidTagPlugin(TAG_PLUGINS_XML));
}
}
} catch (XMLStreamException e) {
- err.jspError("jsp.error.invalid.tagplugin", TAG_PLUGINS_XML, e);
+ err.jspError(MESSAGES.invalidTagPlugin(TAG_PLUGINS_XML), e);
} catch (FactoryConfigurationError e) {
throw new JasperException(e);
} finally {
Modified: trunk/src/main/java/org/apache/jasper/compiler/Validator.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/compiler/Validator.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/compiler/Validator.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.compiler;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.lang.reflect.Method;
import java.util.ArrayList;
import java.util.HashMap;
@@ -103,7 +105,7 @@
public void visit(Node.PageDirective n) throws JasperException {
- JspUtil.checkAttributes("Page directive", n, pageDirectiveAttrs,
+ JspUtil.checkAttributes(TagConstants.PAGE_DIRECTIVE_ACTION, n,
pageDirectiveAttrs,
err);
// JSP.2.10.1
@@ -116,82 +118,82 @@
if (pageInfo.getLanguage(false) == null) {
pageInfo.setLanguage(value, n, err, true);
} else if (!pageInfo.getLanguage(false).equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.language",
- pageInfo.getLanguage(false), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getLanguage(false), value));
}
} else if ("extends".equals(attr)) {
if (pageInfo.getExtends(false) == null) {
pageInfo.setExtends(value, n);
} else if (!pageInfo.getExtends(false).equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.extends",
- pageInfo.getExtends(false), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getExtends(false), value));
}
} else if ("contentType".equals(attr)) {
if (pageInfo.getContentType() == null) {
pageInfo.setContentType(value);
} else if (!pageInfo.getContentType().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.contenttype",
- pageInfo.getContentType(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getContentType(), value));
}
} else if ("session".equals(attr)) {
if (pageInfo.getSession() == null) {
pageInfo.setSession(value, n, err);
} else if (!pageInfo.getSession().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.session",
- pageInfo.getSession(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getSession(), value));
}
} else if ("buffer".equals(attr)) {
if (pageInfo.getBufferValue() == null) {
pageInfo.setBufferValue(value, n, err);
} else if (!pageInfo.getBufferValue().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.buffer",
- pageInfo.getBufferValue(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getBufferValue(), value));
}
} else if ("autoFlush".equals(attr)) {
if (pageInfo.getAutoFlush() == null) {
pageInfo.setAutoFlush(value, n, err);
} else if (!pageInfo.getAutoFlush().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.autoflush",
- pageInfo.getAutoFlush(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getAutoFlush(), value));
}
} else if ("isThreadSafe".equals(attr)) {
if (pageInfo.getIsThreadSafe() == null) {
pageInfo.setIsThreadSafe(value, n, err);
} else if (!pageInfo.getIsThreadSafe().equals(value)) {
- err.jspError(n,
"jsp.error.page.conflict.isthreadsafe",
- pageInfo.getIsThreadSafe(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getIsThreadSafe(), value));
}
} else if ("isELIgnored".equals(attr)) {
if (pageInfo.getIsELIgnored() == null) {
pageInfo.setIsELIgnored(value, n, err, true);
} else if (!pageInfo.getIsELIgnored().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.iselignored",
- pageInfo.getIsELIgnored(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getIsELIgnored(), value));
}
} else if ("isErrorPage".equals(attr)) {
if (pageInfo.getIsErrorPage() == null) {
pageInfo.setIsErrorPage(value, n, err);
} else if (!pageInfo.getIsErrorPage().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.iserrorpage",
- pageInfo.getIsErrorPage(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getIsErrorPage(), value));
}
} else if ("errorPage".equals(attr)) {
if (pageInfo.getErrorPage() == null) {
pageInfo.setErrorPage(value);
} else if (!pageInfo.getErrorPage().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.errorpage",
- pageInfo.getErrorPage(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getErrorPage(), value));
}
} else if ("info".equals(attr)) {
if (pageInfo.getInfo() == null) {
pageInfo.setInfo(value);
} else if (!pageInfo.getInfo().equals(value)) {
- err.jspError(n, "jsp.error.page.conflict.info",
- pageInfo.getInfo(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getInfo(), value));
}
} else if ("pageEncoding".equals(attr)) {
if (pageEncodingSeen)
- err.jspError(n, "jsp.error.page.multi.pageencoding");
+ err.jspError(n.getStart(),
MESSAGES.invalidDuplicatePageDirectiveAttribute(attr));
// 'pageEncoding' can occur at most once per file
pageEncodingSeen = true;
String actual = comparePageEncodings(value, n);
@@ -202,13 +204,8 @@
err, true);
} else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral()
.equals(value)) {
- err
- .jspError(
- n,
-
"jsp.error.page.conflict.deferredsyntaxallowedasliteral",
- pageInfo
- .getDeferredSyntaxAllowedAsLiteral(),
- value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getDeferredSyntaxAllowedAsLiteral(),
value));
}
} else if ("trimDirectiveWhitespaces".equals(attr)) {
if (pageInfo.getTrimDirectiveWhitespaces() == null) {
@@ -216,19 +213,15 @@
true);
} else if (!pageInfo.getTrimDirectiveWhitespaces().equals(
value)) {
- err
- .jspError(
- n,
-
"jsp.error.page.conflict.trimdirectivewhitespaces",
- pageInfo.getTrimDirectiveWhitespaces(),
- value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAttribute
+ (attr, pageInfo.getTrimDirectiveWhitespaces(), value));
}
}
}
// Check for bad combinations
if (pageInfo.getBuffer() == 0 && !pageInfo.isAutoFlush())
- err.jspError(n, "jsp.error.page.badCombo");
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingPageDirectiveAutoFlushBuffer());
// Attributes for imports for this node have been processed by
// the parsers, just add them to pageInfo.
@@ -251,19 +244,19 @@
if (pageInfo.getLanguage(false) == null) {
pageInfo.setLanguage(value, n, err, false);
} else if (!pageInfo.getLanguage(false).equals(value)) {
- err.jspError(n, "jsp.error.tag.conflict.language",
- pageInfo.getLanguage(false), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingTagDirectiveAttributeValues
+ (attr, pageInfo.getLanguage(false), value));
}
} else if ("isELIgnored".equals(attr)) {
if (pageInfo.getIsELIgnored() == null) {
pageInfo.setIsELIgnored(value, n, err, false);
} else if (!pageInfo.getIsELIgnored().equals(value)) {
- err.jspError(n, "jsp.error.tag.conflict.iselignored",
- pageInfo.getIsELIgnored(), value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingTagDirectiveAttributeValues
+ (attr, pageInfo.getIsELIgnored(), value));
}
} else if ("pageEncoding".equals(attr)) {
if (pageEncodingSeen)
- err.jspError(n, "jsp.error.tag.multi.pageencoding");
+ err.jspError(n.getStart(),
MESSAGES.invalidDuplicateTagDirectiveAttribute(attr));
pageEncodingSeen = true;
compareTagEncodings(value, n);
n.getRoot().setPageEncoding(value);
@@ -273,13 +266,8 @@
err, false);
} else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral()
.equals(value)) {
- err
- .jspError(
- n,
-
"jsp.error.tag.conflict.deferredsyntaxallowedasliteral",
- pageInfo
- .getDeferredSyntaxAllowedAsLiteral(),
- value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingTagDirectiveAttributeValues
+ (attr, pageInfo.getDeferredSyntaxAllowedAsLiteral(),
value));
}
} else if ("trimDirectiveWhitespaces".equals(attr)) {
if (pageInfo.getTrimDirectiveWhitespaces() == null) {
@@ -287,12 +275,8 @@
false);
} else if (!pageInfo.getTrimDirectiveWhitespaces().equals(
value)) {
- err
- .jspError(
- n,
-
"jsp.error.tag.conflict.trimdirectivewhitespaces",
- pageInfo.getTrimDirectiveWhitespaces(),
- value);
+ err.jspError(n.getStart(),
MESSAGES.invalidConflictingTagDirectiveAttributeValues
+ (attr, pageInfo.getTrimDirectiveWhitespaces(), value));
}
}
}
@@ -341,9 +325,8 @@
if (!pageDirEnc.equals(configEnc)
&& (!pageDirEnc.startsWith("UTF-16") ||
!configEnc
.startsWith("UTF-16"))) {
- err.jspError(pageDir,
- "jsp.error.config_pagedir_encoding_mismatch",
- configEnc, pageDirEnc);
+ err.jspError(pageDir.getStart(),
+ MESSAGES.pageEncodingConflictJspPropertyGroup(configEnc,
pageDirEnc));
} else {
return configEnc;
}
@@ -361,9 +344,8 @@
if (!pageDirEnc.equals(pageEnc)
&& (!pageDirEnc.startsWith("UTF-16") ||
!pageEnc
.startsWith("UTF-16"))) {
- err.jspError(pageDir,
- "jsp.error.prolog_pagedir_encoding_mismatch",
- pageEnc, pageDirEnc);
+ err.jspError(pageDir.getStart(),
+ MESSAGES.pageEncodingConflictProlog(pageEnc, pageDirEnc));
} else {
return pageEnc;
}
@@ -398,9 +380,8 @@
if (!pageDirEnc.equals(pageEnc)
&& (!pageDirEnc.startsWith("UTF-16") ||
!pageEnc
.startsWith("UTF-16"))) {
- err.jspError(pageDir,
- "jsp.error.prolog_pagedir_encoding_mismatch",
- pageEnc, pageDirEnc);
+ err.jspError(pageDir.getStart(),
+ MESSAGES.pageEncodingConflictProlog(pageEnc, pageDirEnc));
}
}
}
@@ -514,38 +495,36 @@
}
public void visit(Node.JspRoot n) throws JasperException {
- JspUtil.checkAttributes("Jsp:root", n, jspRootAttrs, err);
+ JspUtil.checkAttributes(TagConstants.ROOT_ACTION, n, jspRootAttrs, err);
String version = n.getTextAttribute("version");
if (!version.equals("1.2") &&
!version.equals("2.0") && !version.equals("2.1") &&
!version.equals("2.2")) {
- err.jspError(n, "jsp.error.jsproot.version.invalid", version);
+ err.jspError(n.getStart(), MESSAGES.invalidJspVersionNumber(version));
}
visitBody(n);
}
public void visit(Node.IncludeDirective n) throws JasperException {
- JspUtil.checkAttributes("Include directive", n,
+ JspUtil.checkAttributes(TagConstants.INCLUDE_DIRECTIVE_ACTION, n,
includeDirectiveAttrs, err);
visitBody(n);
}
public void visit(Node.TaglibDirective n) throws JasperException {
- JspUtil.checkAttributes("Taglib directive", n,
+ JspUtil.checkAttributes(TagConstants.TAGLIB_DIRECTIVE_ACTION, n,
taglibDirectiveAttrs, err);
// Either 'uri' or 'tagdir' attribute must be specified
String uri = n.getAttributeValue("uri");
String tagdir = n.getAttributeValue("tagdir");
if (uri == null && tagdir == null) {
- err.jspError(n, "jsp.error.taglibDirective.missing.location");
+ err.jspError(n.getStart(),
MESSAGES.invalidTaglibDirectiveMissingLocation());
}
if (uri != null && tagdir != null) {
- err
- .jspError(n,
-
"jsp.error.taglibDirective.both_uri_and_tagdir");
+ err.jspError(n.getStart(),
MESSAGES.invalidTaglibDirectiveConflictingLocation());
}
}
public void visit(Node.ParamAction n) throws JasperException {
- JspUtil.checkAttributes("Param action", n, paramActionAttrs, err);
+ JspUtil.checkAttributes(TagConstants.PARAM_ACTION, n, paramActionAttrs,
err);
// make sure the value of the 'name' attribute is not a
// request-time expression
throwErrorIfExpression(n, "name", "jsp:param");
@@ -559,13 +538,13 @@
// Make sure we've got at least one nested jsp:param
Node.Nodes subElems = n.getBody();
if (subElems == null) {
- err.jspError(n, "jsp.error.params.emptyBody");
+ err.jspError(n.getStart(), MESSAGES.invalidEmptyJspParams());
}
visitBody(n);
}
public void visit(Node.IncludeAction n) throws JasperException {
- JspUtil.checkAttributes("Include action", n, includeActionAttrs,
+ JspUtil.checkAttributes(TagConstants.INCLUDE_ACTION, n, includeActionAttrs,
err);
n.setPage(getJspAttribute(null, "page", null, null, n
.getAttributeValue("page"), java.lang.String.class, n,
@@ -574,7 +553,7 @@
};
public void visit(Node.ForwardAction n) throws JasperException {
- JspUtil.checkAttributes("Forward", n, forwardActionAttrs, err);
+ JspUtil.checkAttributes(TagConstants.FORWARD_ACTION, n, forwardActionAttrs,
err);
n.setPage(getJspAttribute(null, "page", null, null, n
.getAttributeValue("page"), java.lang.String.class, n,
false));
@@ -582,11 +561,11 @@
}
public void visit(Node.GetProperty n) throws JasperException {
- JspUtil.checkAttributes("GetProperty", n, getPropertyAttrs, err);
+ JspUtil.checkAttributes(TagConstants.GET_PROPERTY_ACTION, n,
getPropertyAttrs, err);
}
public void visit(Node.SetProperty n) throws JasperException {
- JspUtil.checkAttributes("SetProperty", n, setPropertyAttrs, err);
+ JspUtil.checkAttributes(TagConstants.SET_PROPERTY_ACTION, n,
setPropertyAttrs, err);
String property = n.getTextAttribute("property");
String param = n.getTextAttribute("param");
String value = n.getAttributeValue("value");
@@ -598,17 +577,16 @@
if ("*".equals(property)) {
if (param != null || valueSpecified)
- err.jspError(n, "jsp.error.setProperty.invalid");
-
+ err.jspError(n.getStart(), MESSAGES.invalidSetProperty());
} else if (param != null && valueSpecified) {
- err.jspError(n, "jsp.error.setProperty.invalid");
+ err.jspError(n.getStart(), MESSAGES.invalidSetPropertyEitherParam());
}
visitBody(n);
}
public void visit(Node.UseBean n) throws JasperException {
- JspUtil.checkAttributes("UseBean", n, useBeanAttrs, err);
+ JspUtil.checkAttributes(TagConstants.USE_BEAN_ACTION, n, useBeanAttrs, err);
String name = n.getTextAttribute("id");
String scope = n.getTextAttribute("scope");
@@ -618,20 +596,20 @@
BeanRepository beanInfo = pageInfo.getBeanRepository();
if (className == null && type == null)
- err.jspError(n, "jsp.error.usebean.missingType");
+ err.jspError(n.getStart(), MESSAGES.missingUseBeanType());
if (beanInfo.checkVariable(name))
- err.jspError(n, "jsp.error.usebean.duplicate");
+ err.jspError(n.getStart(), MESSAGES.duplicateUseBeanName(name));
if ("session".equals(scope) && !pageInfo.isSession())
- err.jspError(n, "jsp.error.usebean.noSession");
+ err.jspError(n.getStart(),
MESSAGES.cannotAccessSessionScopeWithUseBean());
Node.JspAttribute jattr = getJspAttribute(null, "beanName", null,
null, n.getAttributeValue("beanName"),
java.lang.String.class, n, false);
n.setBeanName(jattr);
if (className != null && jattr != null)
- err.jspError(n, "jsp.error.usebean.notBoth");
+ err.jspError(n.getStart(),
MESSAGES.cannotUseBothAttributeAndTypeInUseBean());
if (className == null)
className = type;
@@ -642,7 +620,7 @@
}
public void visit(Node.PlugIn n) throws JasperException {
- JspUtil.checkAttributes("Plugin", n, plugInAttrs, err);
+ JspUtil.checkAttributes(TagConstants.PLUGIN_ACTION, n, plugInAttrs, err);
throwErrorIfExpression(n, "type", "jsp:plugin");
throwErrorIfExpression(n, "code", "jsp:plugin");
@@ -658,11 +636,11 @@
String type = n.getTextAttribute("type");
if (type == null)
- err.jspError(n, "jsp.error.plugin.notype");
+ err.jspError(n.getStart(), MESSAGES.missingPluginType());
if (!type.equals("bean") &&
!type.equals("applet"))
- err.jspError(n, "jsp.error.plugin.badtype");
+ err.jspError(n.getStart(), MESSAGES.badPluginType(type));
if (n.getTextAttribute("code") == null)
- err.jspError(n, "jsp.error.plugin.nocode");
+ err.jspError(n.getStart(), MESSAGES.missingPluginCode());
Node.JspAttribute width = getJspAttribute(null, "width", null,
null, n.getAttributeValue("width"),
java.lang.String.class,
@@ -678,7 +656,7 @@
}
public void visit(Node.NamedAttribute n) throws JasperException {
- JspUtil.checkAttributes("Attribute", n, attributeAttrs, err);
+ JspUtil.checkAttributes(TagConstants.ATTRIBUTE_ACTION, n, attributeAttrs,
err);
visitBody(n);
if (n.getOmit() != null) {
Attributes attrs = n.getAttributes();
@@ -699,19 +677,19 @@
public void visit(Node.Declaration n) throws JasperException {
if (pageInfo.isScriptingInvalid()) {
- err.jspError(n.getStart(), "jsp.error.no.scriptlets");
+ err.jspError(n.getStart(), MESSAGES.invalidScriptingElement());
}
}
public void visit(Node.Expression n) throws JasperException {
if (pageInfo.isScriptingInvalid()) {
- err.jspError(n.getStart(), "jsp.error.no.scriptlets");
+ err.jspError(n.getStart(), MESSAGES.invalidScriptingElement());
}
}
public void visit(Node.Scriptlet n) throws JasperException {
if (pageInfo.isScriptingInvalid()) {
- err.jspError(n.getStart(), "jsp.error.no.scriptlets");
+ err.jspError(n.getStart(), MESSAGES.invalidScriptingElement());
}
}
@@ -723,7 +701,7 @@
// JSP.2.2 - '#{' not allowed in template text
if (n.getType() == '#') {
if (!pageInfo.isDeferredSyntaxAllowedAsLiteral()) {
- err.jspError(n, "jsp.error.el.template.deferred");
+ err.jspError(n.getStart(),
MESSAGES.invalidDeferredExpressionInTemplateText());
} else {
return;
}
@@ -745,7 +723,7 @@
public void visit(Node.UninterpretedTag n) throws JasperException {
if (n.getNamedAttributeNodes().size() != 0) {
- err.jspError(n, "jsp.error.namedAttribute.invalidUse");
+ err.jspError(n.getStart(), MESSAGES.invalidJspAttribute());
}
Attributes attrs = n.getAttributes();
@@ -757,7 +735,8 @@
String value = attrs.getValue(i);
if (!pageInfo.isDeferredSyntaxAllowedAsLiteral()) {
if (containsDeferredSyntax(value)) {
- err.jspError(n, "jsp.error.el.template.deferred");
+ err.jspError(n.getStart(),
+ MESSAGES.invalidDeferredExpressionInTemplateText());
}
}
jspAttrs[i] = getJspAttribute(null, attrs.getQName(i),
@@ -799,7 +778,7 @@
TagInfo tagInfo = n.getTagInfo();
if (tagInfo == null) {
- err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());
+ err.jspError(n.getStart(), MESSAGES.missingTagInfo(n.getQName()));
}
/*
@@ -808,8 +787,8 @@
if (n.implementsSimpleTag()
&& tagInfo.getBodyContent().equalsIgnoreCase(
TagInfo.BODY_CONTENT_JSP)) {
- err.jspError(n, "jsp.error.simpletag.badbodycontent", tagInfo
- .getTagClassName());
+ err.jspError(n.getStart(), MESSAGES.invalidSimpleTagBodyContent(tagInfo
+ .getTagClassName()));
}
/*
@@ -819,8 +798,7 @@
*/
if (tagInfo.hasDynamicAttributes()
&& !n.implementsDynamicAttributes()) {
- err.jspError(n,
"jsp.error.dynamic.attributes.not.implemented",
- n.getQName());
+ err.jspError(n.getStart(),
MESSAGES.unimplementedDynamicAttributes(n.getQName()));
}
/*
@@ -846,12 +824,11 @@
.getName());
if (tldAttrs[i].isRequired() && attr == null && na ==
null) {
- err.jspError(n, "jsp.error.missing_attribute", tldAttrs[i]
- .getName(), n.getLocalName());
+ err.jspError(n.getStart(),
MESSAGES.missingMandatoryAttribute(n.getLocalName(), tldAttrs[i]
+ .getName()));
}
if (attr != null && na != null) {
- err.jspError(n, "jsp.error.duplicate.name.jspattribute",
- tldAttrs[i].getName());
+ err.jspError(n.getStart(),
MESSAGES.duplicateAttribute(tldAttrs[i].getName()));
}
}
@@ -875,8 +852,7 @@
if (tei != null && tei.getVariableInfo(tagData) != null
&& tei.getVariableInfo(tagData).length > 0
&& tagInfo.getTagVariableInfos().length > 0) {
- err.jspError("jsp.error.non_null_tei_and_var_subelems", n
- .getQName());
+ err.jspError(n.getStart(),
MESSAGES.invalidTeiWithVariableSubelements(n.getQName()));
}
n.setTagData(tagData);
@@ -889,7 +865,7 @@
Attributes attrs = n.getAttributes();
if (attrs == null) {
- err.jspError(n, "jsp.error.jspelement.missing.name");
+ err.jspError(n.getStart(), MESSAGES.missingMandatoryAttributes());
}
int xmlAttrLen = attrs.getLength();
@@ -919,7 +895,7 @@
}
}
if (n.getNameAttribute() == null) {
- err.jspError(n, "jsp.error.jspelement.missing.name");
+ err.jspError(n.getStart(), MESSAGES.missingMandatoryNameAttribute());
}
// Process named attributes
@@ -936,10 +912,10 @@
}
public void visit(Node.JspOutput n) throws JasperException {
- JspUtil.checkAttributes("jsp:output", n, jspOutputAttrs, err);
+ JspUtil.checkAttributes(TagConstants.OUTPUT_ACTION, n, jspOutputAttrs, err);
if (n.getBody() != null) {
- err.jspError(n, "jsp.error.jspoutput.nonemptybody");
+ err.jspError(n.getStart(), MESSAGES.invalidJspOutputBody());
}
String omitXmlDecl = n.getAttributeValue("omit-xml-declaration");
@@ -954,35 +930,35 @@
if (omitXmlDecl != null && omitXmlDeclOld != null
&& !omitXmlDecl.equals(omitXmlDeclOld)) {
- err.jspError(n, "jsp.error.jspoutput.conflict",
- "omit-xml-declaration", omitXmlDeclOld, omitXmlDecl);
+ err.jspError(n.getStart(), MESSAGES.invalidJspOutputConflict
+ ("omit-xml-declaration", omitXmlDeclOld,
omitXmlDecl));
}
if (doctypeName != null && doctypeNameOld != null
&& !doctypeName.equals(doctypeNameOld)) {
- err.jspError(n, "jsp.error.jspoutput.conflict",
- "doctype-root-element", doctypeNameOld, doctypeName);
+ err.jspError(n.getStart(), MESSAGES.invalidJspOutputConflict
+ ("doctype-root-element", doctypeNameOld,
doctypeName));
}
if (doctypePublic != null && doctypePublicOld != null
&& !doctypePublic.equals(doctypePublicOld)) {
- err.jspError(n, "jsp.error.jspoutput.conflict",
- "doctype-public", doctypePublicOld, doctypePublic);
+ err.jspError(n.getStart(), MESSAGES.invalidJspOutputConflict
+ ("doctype-public", doctypePublicOld, doctypePublic));
}
if (doctypeSystem != null && doctypeSystemOld != null
&& !doctypeSystem.equals(doctypeSystemOld)) {
- err.jspError(n, "jsp.error.jspoutput.conflict",
- "doctype-system", doctypeSystemOld, doctypeSystem);
+ err.jspError(n.getStart(), MESSAGES.invalidJspOutputConflict
+ ("doctype-system", doctypeSystemOld, doctypeSystem));
}
if (doctypeName == null && doctypeSystem != null
|| doctypeName != null && doctypeSystem == null) {
- err.jspError(n, "jsp.error.jspoutput.doctypenamesystem");
+ err.jspError(n.getStart(), MESSAGES.errorJspOutputDoctype());
}
if (doctypePublic != null && doctypeSystem == null) {
- err.jspError(n, "jsp.error.jspoutput.doctypepulicsystem");
+ err.jspError(n.getStart(), MESSAGES.errorJspOutputMissingDoctype());
}
if (omitXmlDecl != null) {
@@ -1001,7 +977,7 @@
public void visit(Node.InvokeAction n) throws JasperException {
- JspUtil.checkAttributes("Invoke", n, invokeAttrs, err);
+ JspUtil.checkAttributes(TagConstants.INVOKE_ACTION, n, invokeAttrs, err);
String scope = n.getTextAttribute("scope");
JspUtil.checkScope(scope, n, err);
@@ -1009,16 +985,16 @@
String var = n.getTextAttribute("var");
String varReader = n.getTextAttribute("varReader");
if (scope != null && var == null && varReader == null) {
- err.jspError(n, "jsp.error.missing_var_or_varReader");
+ err.jspError(n.getStart(), MESSAGES.missingVarAttribute());
}
if (var != null && varReader != null) {
- err.jspError(n, "jsp.error.var_and_varReader");
+ err.jspError(n.getStart(), MESSAGES.errorBothVarAttributes());
}
}
public void visit(Node.DoBodyAction n) throws JasperException {
- JspUtil.checkAttributes("DoBody", n, doBodyAttrs, err);
+ JspUtil.checkAttributes(TagConstants.DOBODY_ACTION, n, doBodyAttrs, err);
String scope = n.getTextAttribute("scope");
JspUtil.checkScope(scope, n, err);
@@ -1026,10 +1002,10 @@
String var = n.getTextAttribute("var");
String varReader = n.getTextAttribute("varReader");
if (scope != null && var == null && varReader == null) {
- err.jspError(n, "jsp.error.missing_var_or_varReader");
+ err.jspError(n.getStart(), MESSAGES.missingVarAttribute());
}
if (var != null && varReader != null) {
- err.jspError(n, "jsp.error.var_and_varReader");
+ err.jspError(n.getStart(), MESSAGES.errorBothVarAttributes());
}
}
@@ -1060,7 +1036,7 @@
TagInfo tagInfo = n.getTagInfo();
if (tagInfo == null) {
- err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());
+ err.jspError(n.getStart(), MESSAGES.missingTagInfo(n.getQName()));
}
TagAttributeInfo[] tldAttrs = tagInfo.getAttributes();
Attributes attrs = n.getAttributes();
@@ -1088,14 +1064,12 @@
if (node instanceof ELNode.Root) {
if (((ELNode.Root) node).getType() == '$') {
if (elExpression && deferred) {
- err.jspError(n,
-
"jsp.error.attribute.deferredmix");
+ err.jspError(n.getStart(),
MESSAGES.errorUsingBothElTypes());
}
elExpression = true;
} else if (((ELNode.Root) node).getType() == '#') {
if (elExpression && !deferred) {
- err.jspError(n,
-
"jsp.error.attribute.deferredmix");
+ err.jspError(n.getStart(),
MESSAGES.errorUsingBothElTypes());
}
elExpression = true;
deferred = true;
@@ -1137,9 +1111,8 @@
// Can't specify a literal for a
// deferred method with an expected type
// of void - JSP.2.3.4
- err.jspError(n,
- "jsp.error.literal_with_void",
- tldAttr.getName());
+ err.jspError(n.getStart(),
+
MESSAGES.errorUsingLiteralValueWithDeferredVoidReturnTyep(tldAttr.getName()));
}
if (tldAttr.isDeferredValue()) {
// The String litteral must be castable to what is
declared as type
@@ -1152,8 +1125,7 @@
expectedClass = JspUtil.toClass(expectedType,
loader);
} catch (ClassNotFoundException e) {
err.jspError
- (n,
"jsp.error.unknown_attribute_type",
- tldAttr.getName(), expectedType);
+ (n.getStart(),
MESSAGES.unknownAttributeType(tldAttr.getName(), expectedType));
}
// Check casting - not possible for all types
if (String.class.equals(expectedClass) ||
@@ -1173,8 +1145,8 @@
expressionFactory.coerceToType(attrs.getValue(i), expectedClass);
} catch (Exception e) {
err.jspError
- (n,
"jsp.error.coerce_to_type",
- tldAttr.getName(), expectedType,
attrs.getValue(i));
+ (n.getStart(),
MESSAGES.errorCoercingAttributeValue(
+ tldAttr.getName(), expectedType,
attrs.getValue(i)));
}
}
}
@@ -1187,13 +1159,13 @@
if (deferred && !tldAttr.isDeferredMethod()
&& !tldAttr.isDeferredValue()) {
// No deferred expressions allowed for this
attribute
- err.jspError(n,
"jsp.error.attribute.custom.non_rt_with_expr",
- tldAttr.getName());
+ err.jspError(n.getStart(),
+
MESSAGES.noExpressionAllowedForAttribute(tldAttr.getName()));
}
if (!deferred && !tldAttr.canBeRequestTime()) {
// Only deferred expressions are allowed for this
attribute
- err.jspError(n,
"jsp.error.attribute.custom.non_rt_with_expr",
- tldAttr.getName());
+ err.jspError(n.getStart(),
+
MESSAGES.noExpressionAllowedForAttribute(tldAttr.getName()));
}
Class expectedType = String.class;
@@ -1217,9 +1189,8 @@
try {
jspAttrs[i].validateEL(this.pageInfo.getExpressionFactory(), ctx);
} catch (ELException e) {
- this.err.jspError(n,
-
"jsp.error.invalid.expression",
- attrs.getValue(i), e);
+ err.jspError(n.getStart(),
+
MESSAGES.invalidExpression(attrs.getValue(i)), e);
}
} else {
// Runtime expression
@@ -1231,8 +1202,8 @@
}
} catch (ClassNotFoundException e) {
err.jspError
- (n,
"jsp.error.unknown_attribute_type",
- tldAttrs[j].getName(),
tldAttrs[j].getTypeName());
+ (n.getStart(), MESSAGES.unknownAttributeType
+ (tldAttrs[j].getName(),
tldAttrs[j].getTypeName()));
}
}
@@ -1240,8 +1211,8 @@
// Attribute does not accept any expressions.
// Make sure its value does not contain any.
if (expression) {
- err.jspError(n,
"jsp.error.attribute.custom.non_rt_with_expr",
- tldAttr.getName());
+ err.jspError(n.getStart(),
+
MESSAGES.noExpressionAllowedForAttribute(tldAttr.getName()));
}
jspAttrs[i] = new Node.JspAttribute(tldAttr,
attrs.getQName(i), attrs.getURI(i), attrs
@@ -1266,8 +1237,8 @@
.getValue(i), java.lang.Object.class,
n, true);
} else {
- err.jspError(n, "jsp.error.bad_attribute", attrs
- .getQName(i), n.getLocalName());
+ err.jspError(n.getStart(),
+ MESSAGES.invalidAttributeForTag(attrs.getQName(i),
n.getLocalName()));
}
}
}
@@ -1284,7 +1255,7 @@
TagInfo tagInfo = n.getTagInfo();
if (tagInfo == null) {
- err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());
+ err.jspError(n.getStart(), MESSAGES.missingTagInfo(n.getQName()));
}
TagAttributeInfo[] tldAttrs = tagInfo.getAttributes();
Node.Nodes naNodes = n.getNamedAttributeNodes();
@@ -1328,8 +1299,8 @@
jspAttrs[start + i] = new Node.JspAttribute(na, null,
true);
} else {
- err.jspError(n, "jsp.error.bad_attribute",
- na.getName(), n.getLocalName());
+ err.jspError(n.getStart(),
+ MESSAGES.invalidAttributeForTag(na.getName(),
n.getLocalName()));
}
}
}
@@ -1392,8 +1363,7 @@
.getExpressionFactory(), ctx);
} catch (ELException e) {
this.err.jspError(n.getStart(),
- "jsp.error.invalid.expression", value, e
- .toString());
+ MESSAGES.invalidExpression(value), e);
}
} else {
@@ -1465,9 +1435,8 @@
if (n.getAttributes() != null
&& n.getAttributes().getValue(attrName) != null
&& isExpression(n, n.getAttributes().getValue(attrName),
true)) {
- err.jspError(n,
- "jsp.error.attribute.standard.non_rt_with_expr",
- attrName, actionName);
+ err.jspError(n.getStart(),
+ MESSAGES.noExpressionAllowedForAttributeInAction(attrName,
actionName));
}
}
@@ -1537,14 +1506,9 @@
if (uri == null) {
if (prefix == null) {
- err.jspError(n, "jsp.error.noFunctionPrefix",
- function);
+ err.jspError(n.getStart(),
MESSAGES.missingFunctionPrefix(function));
} else {
- err
- .jspError(
- n,
-
"jsp.error.attribute.invalidPrefix",
- prefix);
+ err.jspError(n.getStart(),
MESSAGES.unknownFunctionPrefix(prefix));
}
}
TagLibraryInfo taglib = pageInfo.getTaglib(uri);
@@ -1553,7 +1517,7 @@
funcInfo = taglib.getFunction(function);
}
if (funcInfo == null) {
- err.jspError(n, "jsp.error.noFunction", function);
+ err.jspError(n.getStart(), MESSAGES.unknownFunction(function));
}
// Skip TLD function uniqueness check. Done by Schema ?
func.setUri(uri);
@@ -1595,14 +1559,11 @@
int start = signature.indexOf(' ');
if (start < 0) {
- err.jspError("jsp.error.tld.fn.invalid.signature", func
- .getPrefix(), func.getName());
+ err.jspError(MESSAGES.invalidFunctionSignature(func.getPrefix(),
func.getName()));
}
int end = signature.indexOf('(');
if (end < 0) {
- err.jspError(
- "jsp.error.tld.fn.invalid.signature.parenexpected",
- func.getPrefix(), func.getName());
+
err.jspError(MESSAGES.invalidFunctionSignatureMissingParent(func.getPrefix(),
func.getName()));
}
return signature.substring(start + 1, end).trim();
}
@@ -1627,8 +1588,7 @@
if (p < 0) {
p = signature.indexOf(')', start);
if (p < 0) {
- err.jspError("jsp.error.tld.fn.invalid.signature",
func
- .getPrefix(), func.getName());
+ err.jspError(MESSAGES.invalidFunctionSignature(func.getPrefix(),
func.getName()));
}
lastArg = true;
}
@@ -1675,10 +1635,8 @@
c = loader.loadClass(n.getFunctionInfo()
.getFunctionClass());
} catch (ClassNotFoundException e) {
- err.jspError("jsp.error.function.classnotfound", n
- .getFunctionInfo().getFunctionClass(), n
- .getPrefix()
- + ':' + n.getName(), e.getMessage());
+ err.jspError(MESSAGES.missingFunctionClass
+ (n.getFunctionInfo().getFunctionClass(), n.getName()),
e);
}
String paramTypes[] = n.getParameters();
int size = paramTypes.length;
@@ -1690,12 +1648,9 @@
}
method = c.getDeclaredMethod(n.getMethodName(), params);
} catch (ClassNotFoundException e) {
- err.jspError("jsp.error.signature.classnotfound",
- paramTypes[i], n.getPrefix() + ':'
- + n.getName(), e.getMessage());
+ err.jspError(MESSAGES.missingSignatureClass(paramTypes[i],
n.getName()), e);
} catch (NoSuchMethodException e) {
- err.jspError("jsp.error.noFunctionMethod", n
- .getMethodName(), n.getName(), c.getName());
+ err.jspError(MESSAGES.missingMethodInClass(n.getMethodName(),
n.getName(), c.getName()));
}
fmapper.mapFunction(n.getPrefix() + ':' + n.getName(),
method);
@@ -1725,15 +1680,14 @@
public void visit(Node.CustomTag n) throws JasperException {
TagInfo tagInfo = n.getTagInfo();
if (tagInfo == null) {
- err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());
+ err.jspError(n.getStart(), MESSAGES.missingTagInfo(n.getQName()));
}
ValidationMessage[] errors = tagInfo.validate(n.getTagData());
if (errors != null && errors.length != 0) {
StringBuilder errMsg = new StringBuilder();
errMsg.append("<h3>");
- errMsg.append(Localizer.getMessage(
- "jsp.error.tei.invalid.attributes", n.getQName()));
+ errMsg.append(MESSAGES.errorValidatingTag(n.getQName()));
errMsg.append("</h3>");
for (int i = 0; i < errors.length; i++) {
errMsg.append("<p>");
@@ -1745,7 +1699,7 @@
errMsg.append("</p>");
}
- err.jspError(n, errMsg.toString());
+ err.jspError(n.getStart(), errMsg.toString());
}
visitBody(n);
@@ -1837,8 +1791,7 @@
errMsg = new StringBuilder();
}
errMsg.append("<h3>");
- errMsg.append(Localizer.getMessage(
- "jsp.error.tlv.invalid.page", tli.getShortName(),
+ errMsg.append(MESSAGES.errorValidatingTaglibrary(tli.getShortName(),
compiler.getPageInfo().getJspFile()));
errMsg.append("</h3>");
for (int i = 0; i < errors.length; i++) {
Deleted: trunk/src/main/java/org/apache/jasper/resources/LocalStrings.properties
===================================================================
--- trunk/src/main/java/org/apache/jasper/resources/LocalStrings.properties 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/resources/LocalStrings.properties 2012-09-21
14:14:07 UTC (rev 2083)
@@ -1,448 +0,0 @@
-# $Id: LocalStrings.properties 1569 2010-10-28 16:28:22Z remy.maucherat(a)jboss.com $
-#
-# Default localized string information
-# Localized this the Default Locale as is en_US
-
-jsp.error.compiler=No Java compiler available
-jsp.error.bad.servlet.engine=Incorrect servlet engine version!
-jsp.error.no.scratch.dir=The JSP engine is not configured with a scratch dir.\
-\n Please add \"jsp.initparams=scratchdir=<dir-name>\" \
-\n in the servlets.properties file for this context.
-jsp.error.bad.scratch.dir=The scratchDir you specified: {0} is unusable.
-jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: {0}
-jsp.message.parent_class_loader_is=Parent class loader is: {0}
-jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated servlets
-jsp.error.not.impl.comments=Internal error: Comments not implemented
-jsp.error.not.impl.directives=Internal error: Directives not implemented
-jsp.error.not.impl.declarations=Internal error: Declarations not implemented
-jsp.error.not.impl.expressions=Internal error: Expressions not implemented
-jsp.error.not.impl.scriptlets=Internal error: Scriptlets not implemented
-jsp.error.not.impl.usebean=Internal error: useBean not implemented
-jsp.error.not.impl.getp=Internal error: getProperty not implemented
-jsp.error.not.impl.setp=Internal error: setProperty not implemented
-jsp.error.not.impl.plugin=Internal error: plugin not implemented
-jsp.error.not.impl.forward=Internal error: forward not implemented
-jsp.error.not.impl.include=Internal error: include not implemented
-jsp.error.unavailable=JSP has been marked unavailable
-jsp.error.usebean.missing.attribute=useBean: id attribute missing or misspelled
-jsp.error.usebean.missing.type=useBean ({0}): Either class or type attribute must be \
-specified:
-jsp.error.usebean.duplicate=useBean: Duplicate bean name: {0}
-jsp.error.usebean.prohibited.as.session=Can't use as session bean {0} since it is
prohibited \
-by jsp directive defined earlier:
-jsp.error.usebean.not.both=useBean: Can't specify both class and beanName attribute:
-jsp.error.usebean.bad.type.cast=useBean ({0}): Type ({1}) is not assignable from class
({2})
-jsp.error.invalid.scope=Illegal value of \'scope\' attribute: {0} (must be one of
\"page\", \"request\", \"session\", or
\"application\")
-jsp.error.classname=Can't determine classname from .class file
-jsp.error.outputfolder=No output folder
-jsp.warning.bad.type=Warning: bad type in .class file
-jsp.error.data.file.write=Error while writing data file
-jsp.error.page.invalid.buffer=Page directive: invalid buffer size
-jsp.error.page.conflict.contenttype=Page directive: illegal to have multiple occurrences
of 'contentType' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.contenttype=Page directive: invalid value for contentType
-jsp.error.page.conflict.session=Page directive: illegal to have multiple occurrences of
'session' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.session=Page directive: invalid value for session
-jsp.error.page.conflict.buffer=Page directive: illegal to have multiple occurrences of
'buffer' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.buffer=Page directive: invalid value for buffer
-jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple occurrences of
'autoFlush' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.autoflush=Page directive: invalid value for autoFlush
-jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple occurrences
of 'isThreadSafe' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.isthreadsafe=Page directive: invalid value for isThreadSafe
-jsp.error.page.conflict.info=Page directive: illegal to have multiple occurrences of
'info' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.info=Page directive: invalid value for info
-jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple occurrences
of 'isErrorPage' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.iserrorpage=Page directive: invalid value for isErrorPage
-jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple occurrences of
'errorPage' with different values (old: {0}, new: {1})
-jsp.error.page.conflict.language=Page directive: illegal to have multiple occurrences of
'language' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of
'language' with different values (old: {0}, new: {1})
-jsp.error.page.language.nonjava=Page directive: invalid language attribute
-jsp.error.tag.language.nonjava=Tag directive: invalid language attribute
-jsp.error.page.defafteruse.language=Page directive: can't define language after a
scriptlet
-jsp.error.page.nomapping.language=Page directive: No mapping for language:
-jsp.error.page.conflict.extends=Page directive: illegal to have multiple occurrences of
'extends' with different values (old: {0}, new: {1})
-jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple occurrences
of 'isELIgnored' with different values (old: {0}, new: {1})
-jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of
'isELIgnored' with different values (old: {0}, new: {1})
-jsp.error.page.invalid.iselignored=Page directive: invalid value for isELIgnored
-jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored
-jsp.error.page.multi.pageencoding=Page directive must not have multiple occurrences of
pageencoding
-jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the
attribute \"{0}\" with different values (old: {1}, new: {2})
-jsp.error.tag.multi.pageencoding=Tag directive must not have multiple occurrences of
pageencoding
-jsp.error.page.bad_b_and_a_combo=Page directive: Illegal combination of
buffer=\"none\" && autoFlush=\"false\"
-jsp.error.not.impl.taglib=Internal error: Tag extensions not implemented
-jsp.error.include.missing.file=Missing file argument to include
-jsp.error.include.bad.file=Bad file argument to include
-jsp.error.include.exception=Unable to include {0}
-jsp.error.stream.closed=Stream closed
-jsp.error.invalid.forward=Invalid forward tag
-jsp.error.unknownException=Unhandled error! You might want to consider having an error
page \
-to report such errors more gracefully
-jsp.error.invalid.directive=Invalid directive
-jsp.error.invalid.implicit=Invalid implicit TLD for tag file at {0}
-jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag
file at {0}
-jsp.error.invalid.version=Invalid JSP version defined for tag file at {0}
-jsp.error.directive.istagfile={0} directive cannot be used in a tag file
-jsp.error.directive.isnottagfile={0} directive can only be used in a tag file
-jsp.error.tagfile.tld.name=The \"name\" attribute of the tag directive has a
value {0} while the \"name\" tag of the \"tag-file\" element in the
TLD is {1}
-jsp.error.action.istagfile={0} action cannot be used in a tag file
-jsp.error.action.isnottagfile={0} action can be used in tag files only
-jsp.error.unterminated=Unterminated {0} tag
-jsp.error.usebean.notinsamefile=useBean tag must begin and end in the same physical file
-jsp.error.loadclass.taghandler=Unable to load tag handler class \"{0}\" for tag
\"{1}\"
-jsp.error.unable.compile=Unable to compile class for JSP
-jsp.error.unable.load=Unable to load class for JSP
-jsp.error.unable.rename=Unable to rename class file {0} to {1}
-jsp.error.mandatory.attribute={0}: Mandatory attribute {1} missing
-jsp.error.flush=Exception occurred when flushing data
-jsp.engine.info=Jasper JSP 2.1 Engine
-jsp.error.invalid.expression="{0}" contains invalid expression(s): {1}
-jsp.error.invalid.attribute={0} has invalid attribute: {1}
-jsp.error.usebean.class.notfound=Class: {0} not found
-jsp.error.file.cannot.read=Cannot read file: {0}
-jsp.error.file.already.registered=Recursive include of file {0}
-jsp.error.file.not.registered=file {0} not seen in include
-jsp.error.quotes.unterminated=Unterminated quotes
-jsp.error.attr.quoted=Attribute value should be quoted
-jsp.error.attr.novalue=Attribute {0} has no value
-jsp.error.tag.attr.unterminated=Unterminated tag attribute list
-jsp.error.param.noname=No name in PARAM tag
-jsp.error.param.novalue=No value in PARAM tag
-jsp.error.beans.nullbean=Attempted a bean operation on a null object.
-jsp.error.beans.nobeaninfo=No BeanInfo for the bean of type ''{0}'' could
be found, the class likely does not exist.
-jsp.error.beans.introspection=An exception occurred while introspecting the read method
of property ''{0}'' in a bean of type ''{1}'':\n{2}
-jsp.error.beans.nomethod=Cannot find a method to read property ''{0}'' in
a bean of type ''{1}''
-jsp.error.beans.nomethod.setproperty=Can''t find a method to write property
''{0}'' of type ''{1}'' in a bean of type
''{2}''
-jsp.error.beans.noproperty=Cannot find any information on property
''{0}'' in a bean of type ''{1}''
-jsp.error.beans.property.conversion=Unable to convert string \"{0}\" to class
\"{1}\" for attribute \"{2}\": {3}
-jsp.error.beans.propertyeditor.notregistered=Property Editor not registered with the
PropertyEditorManager
-jsp.error.beans.setproperty.noindexset=Cannot set indexed property
-jsp.error.include.tag=Invalid jsp:include tag
-jsp.error.include.noflush=jsp:include needs to have \"flush=true\"
-jsp.error.include.badflush=jsp:include page=\"...\" flush=\"true\" is
the only valid combination in JSP 1.0
-jsp.error.attempt_to_clear_flushed_buffer=Error: Attempt to clear a buffer that's
already been flushed
-jsp.error.overflow=Error: JSP Buffer overflow
-jsp.error.paramexpected=Expecting \"jsp:param\" standard action with
\"name\" and \"value\" attributes
-jsp.error.param.invalidUse=The jsp:param action must not be used outside the jsp:include,
jsp:forward, or jsp:params elements
-jsp.error.params.invalidUse=jsp:params must be a direct child of jsp:plugin
-jsp.error.fallback.invalidUse=jsp:fallback must be a direct child of jsp:plugin
-jsp.error.namedAttribute.invalidUse=jsp:attribute must be the subelement of a standard or
custom action
-jsp.error.jspbody.invalidUse=jsp:body must be the subelement of a standard or custom
action
-jsp.error.closeindividualparam=param tag needs to be closed with \"/>\"
-jsp.error.closeparams=param tag needs to be closed with /params
-jsp.error.params.emptyBody=jsp:params must contain at least one nested jsp:param
-jsp.error.params.illegalChild=jsp:params must not have any nested elements other than
jsp:param
-jsp.error.plugin.notype=type not declared in jsp:plugin
-jsp.error.plugin.badtype=Illegal value for 'type' attribute in jsp:plugin: must
be 'bean' or 'applet'
-jsp.error.plugin.nocode=code not declared in jsp:plugin
-jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0
-jsp.error.setproperty.beanNotFound=setProperty: Bean {0} not found
-jsp.error.getproperty.beanNotFound=getProperty: Bean {0} not found
-jsp.error.setproperty.ClassNotFound=setProperty: Class {0} not found
-jsp.error.javac=Javac exception
-jsp.error.javac.env=Environment:
-jsp.error.compilation=Error compiling file: {0} {1}
-# typo ?
-#jsp.error.setproperty.invalidSayntax=setProperty: can't have non-null value when
property=*
-jsp.error.setproperty.invalidSyntax=setProperty: can't have non-null value when
property=*
-jsp.error.setproperty.beanInfoNotFound=setproperty: beanInfo for bean {0} not found
-jsp.error.setproperty.paramOrValue=setProperty: either param or value can be present
-jsp.error.setproperty.arrayVal=setProperty: can't set array property {0} through a
string constant value
-jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated. Will use the
default value of \"false\"
-jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy. Will use the
default value of \"false\"
-jsp.warning.enablePooling=Warning: Invalid value for the initParam enablePooling. Will
use the default value of \"true\"
-jsp.warning.invalidTagPoolSize=Warning: Invalid value for the init parameter named
tagPoolSize. Will use default size of {0}
-jsp.warning.mappedFile=Warning: Invalid value for the initParam mappedFile. Will use the
default value of \"false\"
-jsp.warning.sendErrToClient=Warning: Invalid value for the initParam sendErrToClient.
Will use the default value of \"false\"
-jsp.warning.classDebugInfo=Warning: Invalid value for the initParam classdebuginfo. Will
use the default value of \"false\"
-jsp.warning.checkInterval=Warning: Invalid value for the initParam checkInterval. Will
use the default value of \"300\" seconds
-jsp.warning.modificationTestInterval=Warning: Invalid value for the initParam
modificationTestInterval. Will use the default value of \"4\" seconds
-jsp.warning.recompileOnFail=Warning: Invalid value for the initParam recompileOnFail.
Will use the default value of \"false\" seconds
-jsp.warning.development=Warning: Invalid value for the initParam development. Will use
the default value of \"true\"
-jsp.warning.fork=Warning: Invalid value for the initParam fork. Will use the default
value of \"true\"
-jsp.warning.reloading=Warning: Invalid value for the initParam reloading. Will use the
default value of \"true\"
-jsp.warning.dumpSmap=Warning: Invalid value for the initParam dumpSmap. Will use the
default value of \"false\"
-jsp.warning.genchararray=Warning: Invalid value for the initParam genStrAsCharArray. Will
use the default value of \"false\"
-jsp.warning.suppressSmap=Warning: Invalid value for the initParam suppressSmap. Will use
the default value of \"false\"
-jsp.warning.displaySourceFragment=Warning: Invalid value for the initParam
displaySourceFragment. Will use the default value of \"true\"
-jsp.error.badtaglib=Unable to open taglibrary {0} : {1}
-jsp.error.badGetReader=Cannot create a reader when the stream is not buffered
-jsp.warning.unknown.element.in.taglib=Unknown element ({0}) in taglib
-jsp.warning.unknown.element.in.tag=Unknown element ({0}) in tag
-jsp.warning.unknown.element.in.tagfile=Unknown element ({0}) in tag-file
-jsp.warning.unknown.element.in.attribute=Unknown element ({0}) in attribute
-jsp.warning.unknown.element.in.variable=Unknown element ({0}) in variable
-jsp.warning.unknown.element.in.validator=Unknown element ({0}) in validator
-jsp.warning.unknown.element.in.initParam=Unknown element ({0}) in validator's
init-param
-jsp.warning.unknown.element.in.function=Unknown element ({0}) in function
-jsp.error.more.than.one.taglib=More than one taglib in the TLD: {0}
-jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: {0}
-jsp.error.non_null_tei_and_var_subelems=Tag {0} has one or more variable subelements and
a TagExtraInfo class that returns one or more VariableInfo
-jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: {0}
-jsp.error.unable.to.open.TLD=Unable to open the tag library descriptor: {0}
-jsp.buffer.size.zero=Buffer size <= 0
-jsp.error.file.not.found=File \"{0}\" not found
-jsp.message.copyinguri=Copying {0} into {1}
-jsp.message.htmlcomment=\nStripping Comment: \t{0}
-jsp.message.handling_directive=\nHandling Directive: {0}\t{1}
-jsp.message.handling_plugin=\nPlugin: {0}
-jsp.message.package_name_is=Package name is: {0}
-jsp.message.class_name_is=Class name is: {0}
-jsp.message.java_file_name_is=Java file name is: {0}
-jsp.message.class_file_name_is=Class file name is: {0}
-jsp.message.accepted=Accepted {0} at {1}
-jsp.message.adding_jar=Adding jar {0} to my classpath
-jsp.message.compiling_with=Compiling with: {0}
-jsp.message.template_text=template text
-jsp.error.missing_attribute=According to the TLD or the tag file, attribute {0} is
mandatory for tag {1}
-jsp.error.bad_attribute=Attribute {0} invalid for tag {1} according to TLD
-jsp.error.tld.unable_to_read=Unable to read TLD \"{1}\" from JAR file
\"{0}\": {2}
-jsp.error.tld.unable_to_get_jar=Unable to get JAR resource \"{0}\" containing
TLD: {1}
-jsp.error.tld.missing_jar=Missing JAR resource \"{0}\" containing TLD
-jsp.error.webxml_not_found=Could not locate web.xml
-jsp.cmd_line.usage=Usage: jsptoservlet [-dd <path/to/outputDirectory>]
[-keepgenerated] \
-<.jsp files>
-jsp.message.cp_is=Classpath {0} is: {1}
-jsp.error.unable.to_load_taghandler_class=Unable to load tag handler class {0} because of
{1}
-jsp.error.unable.to_find_method=Unable to find setter method for attribute: {0}
-jsp.error.unable.to_convert_string=Unable to convert a String to {0} for attribute {1}
-jsp.error.unable.to_introspect=Unable to introspect on tag handler class: {0} because of
{1}
-jsp.error.bad_tag=No tag \"{0}\" defined in tag library imported with prefix
\"{1}\"
-jsp.error.xml.bad_tag=No tag \"{0}\" defined in tag library associated with uri
\"{1}\"
-jsp.error.bad_string_Character=Cannot extract a Character from a zero length array
-jsp.error.bad_string_char=Cannot extract a char from a zero length array
-jsp.warning.compiler.class.cantcreate=Can't create an instance of specified compiler
plugin class {0} due to {1}. Will default to Sun Java Compiler.
-jsp.warning.compiler.class.notfound=Specified compiler plugin class {0} not found. Will
default to Sun Java Compiler.
-jsp.warning.compiler.path.notfound=Specified compiler path {0} not found. Will default to
system PATH.
-jsp.error.jspc.uriroot_not_dir=The -uriroot option must specify a pre-existing directory
-jsp.error.jspc.missingTarget=Missing target: Must specify -webapp or -uriroot, or one or
more JSP pages
-jsp.error.jspc.no_uriroot=The uriroot is not specified and cannot be located with the
specified JSP file(s)
-jspc.implicit.uriRoot=uriRoot implicitly set to "{0}"
-jspc.usage=Usage: jspc <options> [--] <jsp files>\n\
-where jsp files is\n\
-\ -webapp <dir> A directory containing a web-app, whose JSP pages\n\
-\ will be processed recursively\n\
-or any number of\n\
-\ <file> A file to be parsed as a JSP page\n\
-where options include:\n\
-\ -help Print this help message\n\
-\ -v Verbose mode\n\
-\ -d <dir> Output Directory (default -Djava.io.tmpdir)\n\
-\ -l Outputs the name of the JSP page upon failure\n\
-\ -s Outputs the name of the JSP page upon success\n\
-\ -p <name> Name of target package (default org.apache.jsp)\n\
-\ -c <name> Name of target class name (only applies to first JSP
page)\n\
-\ -mapped Generates separate write() calls for each HTML line in the
JSP\n\
-\ -die[#] Generates an error return code (#) on fatal errors (default
1)\n\
-\ -uribase <dir> The uri directory compilations should be relative to\n\
-\ (default "/")\n\
-\ -uriroot <dir> Same as -webapp\n\
-\ -compile Compiles generated servlets\n\
-\ -webinc <file> Creates a partial servlet mappings in the file\n\
-\ -webxml <file> Creates a complete web.xml in the file\n\
-\ -ieplugin <clsid> Java Plugin classid for Internet Explorer\n\
-\ -classpath <path> Overrides java.class.path system property\n\
-\ -xpoweredBy Add X-Powered-By response header\n\
-\ -trimSpaces Trim spaces in template text between actions, directives\n\
-\ -javaEncoding <enc> Set the encoding charset for Java classes (default
UTF-8)\n\
-\ -source <version> Set the -source argument to the compiler (default 1.4)\n\
-\ -target <version> Set the -target argument to the compiler (default 1.4)\n\
-
-jspc.webxml.header=<?xml version="1.0"
encoding="ISO-8859-1"?>\n\
-\n\
-<!DOCTYPE web-app\n\
-\ PUBLIC "-//Sun Microsystems, Inc.//DTD Web Application 2.3//EN"\n\
-\ "http://java.sun.com/dtd/web-app_2_3.dtd">\n\
-<!--\n\
-Automatically created by Apache Jakarta Tomcat JspC.\n\
--->\n\
-<web-app>\n\
-\n
-jspc.webxml.footer=\n\
-</web-app>\n\
-\n
-jspc.webinc.header=\n\
-<!--\n\
-Automatically created by Apache Jakarta Tomcat JspC.\n\
-Place this fragment in the web.xml before all icon, display-name,\n\
-description, distributable, and context-param elements.\n\
--->\n
-jspc.webinc.footer=\n\
-<!--\n\
-All session-config, mime-mapping, welcome-file-list, error-page, taglib,\n\
-resource-ref, security-constraint, login-config, security-role,\n\
-env-entry, and ejb-ref elements should follow this fragment.\n\
--->\n
-jspc.webinc.insertEnd=<!-- JSPC servlet mappings end -->
-jspc.webinc.insertStart=<!-- JSPC servlet mappings start -->
-jspc.error.jasperException=error-the file ''{0}'' generated the following
parse exception: {1}
-jspc.error.generalException=ERROR-the file ''{0}'' generated the
following general exception:
-jspc.error.fileDoesNotExist=The file argument ''{0}'' does not exist
-jspc.error.emptyWebApp=-webapp requires a trailing file argument
-jsp.error.library.invalid=JSP page is invalid according to library {0}: {1}
-jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class:
{0}
-jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator for {0} in
{1}
-jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for {0}
-jsp.parser.sax.propertynotsupported=SAX property not supported: {0}
-jsp.parser.sax.propertynotrecognized=SAX property not recognized: {0}
-jsp.parser.sax.featurenotsupported=SAX feature not supported: {0}
-jsp.parser.sax.featurenotrecognized=SAX feature not recognized: {0}
-jsp.error.no.more.content=End of content reached while more parsing required: tag nesting
error?
-jsp.error.parse.xml=XML parsing error on file {0}
-jsp.error.parse.xml.line=XML parsing error on file {0}: (line {1}, col {2})
-jsp.error.parse.xml.scripting.invalid.body=Body of {0} element must not contain any XML
elements
-jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: {0}
-jsp.error.internal.filenotfound=Internal Error: File {0} not found
-jsp.error.internal.evaluator_not_found=Internal error: unable to load expression
evaluator
-jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: {0}
-jsp.error.include.flush.invalid.value=Invalid value for the flush attribute: {0}
-jsp.error.unsupported.encoding=Unsupported encoding: {0}
-tld.error.variableNotAllowed=It is an error for a tag that has one or more variable
subelements to have a TagExtraInfo class that returns a non-null object.
-jsp.error.tldInWebDotXmlNotFound=Could not locate TLD {1} for URI {0} specified in
web.xml
-jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: {0} cannot be resolved
in either web.xml or the jar files deployed with this application
-jsp.error.taglibDirective.missing.location=Neither \'uri\' nor \'tagdir\'
attribute specified
-jsp.error.taglibDirective.both_uri_and_tagdir=Both \'uri\' and \'tagdir\'
attributes specified
-jsp.error.invalid.tagdir=Tag file directory {0} does not start with
\"/WEB-INF/tags\"
-jsp.error.unterminated.user.tag=Unterminated user-defined tag: ending tag {0} not found
or incorrectly nested
-#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
{1}
-jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}> cannot
have template data. Template data must be encapsulated within a <jsp:text>
element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: {1}
-#Error while processing taglib jar file {0}: {1}
-jsp.error.taglib.reserved.prefix=The taglib prefix {0} is reserved
-jsp.error.invalid.javaEncoding=Invalid java encodings. Tried {0} and then {1}. Both
failed.
-jsp.error.needAlternateJavaEncoding=Default java encoding {0} is invalid on your java
platform. An alternate can be specified via the 'javaEncoding' parameter of
JspServlet.
-#Error when compiling, used for jsp line number error messages
-jsp.error.single.line.number=An error occurred at line: {0} in the jsp file: {1}
-jsp.error.multiple.line.number=\n\nAn error occurred between lines: {0} and {1} in the
jsp file: {2}\n\n
-jsp.error.java.line.number=An error occurred at line: {0} in the generated java file
-jsp.error.corresponding.servlet=Generated servlet error:\n
-jsp.error.empty.body.not.allowed=Empty body not allowed for {0}
-jsp.error.jspbody.required=Must use jsp:body to specify tag body for {0} if jsp:attribute
is used.
-jsp.error.jspbody.emptybody.only=The {0} tag can only have jsp:attribute in its body.
-jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration,
<%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed
here.
-jsp.error.internal.unexpected_node_type=Internal Error: Unexpected node type encountered
-jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD. Tag
Library: {0}, Function: {1}
-jsp.error.tld.fn.duplicate.name=Duplicate function name {0} in tag library {1}
-jsp.error.tld.fn.invalid.signature.commaexpected=Invalid syntax for function signature in
TLD. Comma ',' expected. Tag Library: {0}, Function: {1}.
-jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function signature in
TLD. Parenthesis '(' expected. Tag Library: {0}, Function: {1}.
-jsp.error.tld.mandatory.element.missing=Mandatory TLD element missing or empty: {0}
-jsp.error.dynamic.attributes.not.implemented=The {0} tag declares that it accepts dynamic
attributes but does not implement the required interface
-jsp.error.nomatching.fragment=Cannot find an attribute directive (with name={0} and
fragment=true) prior to the fragment directive.
-jsp.error.attribute.noequal=equal symbol expected
-jsp.error.attribute.noquote=quote symbol expected
-jsp.error.attribute.unterminated=attribute for {0} is not properly terminated
-jsp.error.attribute.noescape=Attribute value {0} is quoted with {1} which must be escaped
when used within the value
-jsp.error.missing.tagInfo=TagInfo object for {0} is missing from TLD
-jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature
if 'deferredMethod' is not 'true'
-jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if
'deferredValue' is not 'true'
-jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod'
cannot be both 'true'
-jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type'
attributes. If 'fragment' is present, 'type' is fixed as
'javax.servlet.jsp.tagext.JspFragment'
-jsp.error.fragmentwithrtexprvalue=Cannot specify both 'fragment' and
'rtexprvalue' attributes. If 'fragment' is present, 'rtexprvalue'
is fixed as 'true'
-jsp.error.fragmentWithDeclareOrScope=Both 'fragment' and 'declare' or
'scope' attributes specified in variable directive
-jsp.error.var_and_varReader=Only one of \'var\' or \'varReader\' may be
specified
-jsp.error.missing_var_or_varReader=Missing \'var\' or \'varReader\'
attribute
-jsp.warning.bad.urlpattern.propertygroup=Bad value {0} in the url-pattern subelement in
web.xml
-jsp.error.literal_with_void=A literal value was specified for attribute {0} that is
defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal
values in this case
-jsp.error.unknown_attribute_type=Unknown attribute type ({1}) for attribute {0}.
-jsp.error.coerce_to_type=Cannot coerce value ({2}) to type ({1}) for attribute {0}.
-jsp.error.jspelement.missing.name=Mandatory XML-style \'name\' attribute missing
-jsp.error.xmlns.redefinition.notimplemented=Internal error: Attempt to redefine
xmlns:{0}. Redefinition of namespaces is not implemented.
-jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries: {0}
-jsp.error.duplicate.name.jspattribute=The attribute {0} specified in the standard or
custom action also appears as the value of the name attribute in the enclosed
jsp:attribute
-jsp.error.not.in.template={0} not allowed in a template text body.
-jsp.error.badStandardAction=Invalid standard action
-jsp.error.xml.badStandardAction=Invalid standard action: {0}
-jsp.error.tagdirective.badbodycontent=Invalid body-content ({0}) in tag directive
-jsp.error.simpletag.badbodycontent=The TLD for the class {0} specifies an invalid
body-content (JSP) for a SimpleTag.
-jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group
({0}) is different from that specified in page directive ({1})
-jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog ({0}) is
different from that specified in page directive ({1})
-jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog ({0}) is
different from that specified in jsp-property-group ({1})
-jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in
tag file, attribute {0} does not accept any expressions
-jsp.error.attribute.standard.non_rt_with_expr=The {0} attribute of the {1} standard
action does not accept any expressions
-jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in the same
attribute value
-jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name
from attribute {0}
-jasper.error.emptybodycontent.nonempty=According to TLD, tag {0} must be empty, but is
not
-jsp.error.tagfile.nameNotUnique=The value of {0} and the value of {1} in line {2} are the
same.
-jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name
attribute with a value \"{0}\", the value of this name-from-attribute
attribute.
-jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line {1} and
whose name attribute is \"{0}\", the value of this name-from-attribute
attribute) must be of type java.lang.String, is \"required\" and not a
\"rtexprvalue\".
-jsp.error.page.noSession=Cannot access session scope in page that does not participate in
any session
-jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page
declares (via page directive) that it does not participate in sessions
-jsp.error.xml.encodingByteOrderUnsupported = Given byte order for encoding
\"{0}\" is not supported.
-jsp.error.xml.encodingDeclInvalid = Invalid encoding name \"{0}\".
-jsp.error.xml.encodingDeclRequired = The encoding declaration is required in the text
declaration.
-jsp.error.xml.morePseudoAttributes = more pseudo attributes is expected.
-jsp.error.xml.noMorePseudoAttributes = no more pseudo attributes is allowed.
-jsp.error.xml.versionInfoRequired = The version is required in the XML declaration.
-jsp.error.xml.xmlDeclUnterminated = The XML declaration must end with
\"?>\".
-jsp.error.xml.reservedPITarget = The processing instruction target matching
\"[xX][mM][lL]\" is not allowed.
-jsp.error.xml.spaceRequiredInPI = White space is required between the processing
instruction target and data.
-jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x{0}) was found
in the element content of the document.
-jsp.error.xml.spaceRequiredBeforeStandalone = White space is required before the encoding
pseudo attribute in the XML declaration.
-jsp.error.xml.sdDeclInvalid = The standalone document declaration value must be
\"yes\" or \"no\", not \"{0}\".
-jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x{0}) was found in
the processing instruction.
-jsp.error.xml.versionNotSupported = XML version \"{0}\" is not supported, only
XML 1.0 is supported.
-jsp.error.xml.pseudoAttrNameExpected = a pseudo attribute name is expected.
-jsp.error.xml.expectedByte = Expected byte {0} of {1}-byte UTF-8 sequence.
-jsp.error.xml.invalidByte = Invalid byte {0} of {1}-byte UTF-8 sequence.
-jsp.error.xml.operationNotSupported = Operation \"{0}\" not supported by {1}
reader.
-jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not
exceed 0x10 but found 0x{0}.
-jsp.error.xml.invalidASCII = Byte \"{0}\" not 7-bit ASCII.
-jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = White space is required before the
encoding pseudo attribute in the XML declaration.
-jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = White space is required before the
encoding pseudo attribute in the text declaration.
-jsp.error.xml.spaceRequiredBeforeVersionInTextDecl = White space is required before the
version pseudo attribute in the text declaration.
-jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl = White space is required before the
version pseudo attribute in the XML declaration.
-jsp.error.xml.eqRequiredInXMLDecl = The '' = '' character must follow
\"{0}\" in the XML declaration.
-jsp.error.xml.eqRequiredInTextDecl = The '' = '' character must follow
\"{0}\" in the text declaration.
-jsp.error.xml.quoteRequiredInTextDecl = The value following \"{0}\" in the text
declaration must be a quoted string.
-jsp.error.xml.quoteRequiredInXMLDecl = The value following \"{0}\" in the XML
declaration must be a quoted string.
-jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode: 0x{0}) was found
in the text declaration.
-jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x{0}) was found
in the XML declaration.
-jsp.error.xml.closeQuoteMissingInTextDecl = closing quote in the value following
\"{0}\" in the text declaration is missing.
-jsp.error.xml.closeQuoteMissingInXMLDecl = closing quote in the value following
\"{0}\" in the XML declaration is missing.
-jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not
exceed 0x10 but found 0x{0}.
-jsp.error.multiple.jsp = Cannot have multiple specifications of
-jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple
occurrences of \"{0}\" with different values (old: {1}, new: {2})
-jsp.error.jspoutput.doctypenamesystem=<jsp:output>:
'doctype-root-element' and 'doctype-system' attributes must appear
together
-jsp.error.jspoutput.doctypepulicsystem=<jsp:output>:
'doctype-system' attribute must appear if 'doctype-public' attribute
appears
-jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body
-jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard
syntax
-jsp.error.attributes.not.allowed = {0} must not have any attributes
-jsp.error.tagfile.badSuffix=Missing \".tag\" suffix in tag file path {0}
-jsp.error.tagfile.illegalPath=Illegal tag file path: {0}, must start with
\"/WEB-INF/tags\" or \"/META-INF/tags\"
-jsp.error.plugin.wrongRootElement=Name of root element in {0} different from {1}
-jsp.error.attribute.invalidPrefix=The attribute prefix {0} does not correspond to any
imported tag library
-jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within
another jsp:attribute standard action
-jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another
jsp:body or jsp:attribute standard action
-jsp.error.variable.either.name=Either name-given or name-from-attribute attribute must be
specified in a variable directive
-jsp.error.variable.both.name=Cannot specify both name-given or name-from-attribute
attributes in a variable directive
-jsp.error.variable.alias=Both or none of the name-from-attribute and alias attributes
must be specified in a variable directive
-jsp.error.attribute.null_name=Null attribute name
-jsp.error.jsptext.badcontent=\'<\', when appears in the body of
<jsp:text>, must be encapsulated within a CDATA
-jsp.error.jsproot.version.invalid=Invalid version number: \"{0}\", must be
\"1.2\", \"2.0\", or \"2.1\"
-jsp.error.noFunctionPrefix=The function {0} must be used with a prefix when a default
namespace is not specified
-jsp.error.noFunction=The function {0} cannot be located with the specified prefix
-jsp.error.noFunctionMethod=Method \"{0}\" for function \"{1}\" not
found in class \"{2}\"
-jsp.error.function.classnotfound=The class {0} specified in TLD for the function {1}
cannot be found: {2}
-jsp.error.signature.classnotfound=The class {0} specified in the method signature in TLD
for the function {1} cannot be found. {2}
-jsp.error.text.has_subelement=<jsp:text> must not have any subelements
-jsp.error.data.file.read=Error reading file \"{0}\"
-jsp.error.prefix.refined=Attempt to redefine the prefix {0} to {1}, when it was already
defined as {2} in the current scope.
-jsp.error.nested_jsproot=Nested <jsp:root>
-jsp.error.unbalanced.endtag=The end tag \"</{0}\" is unbalanced
-jsp.error.invalid.bean=The value for the useBean class attribute {0} is invalid.
-jsp.error.prefix.use_before_dcl=The prefix {0} specified in this tag directive has been
previously used by an action in file {1} line {2}.
-
-jsp.exception=An exception occurred processing JSP page {0} at line {1}
-
-# JSP 2.1
-jsp.error.el.template.deferred=#{..} is not allowed in template text
-jsp.error.el.parse={0} : {1}
-jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid value for
deferredSyntaxAllowedAsLiteral
-jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for
deferredSyntaxAllowedAsLiteral
-jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal to have
multiple occurrences of 'deferredSyntaxAllowedAsLiteral' with different values
(old: {0}, new: {1})
-jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have
multiple occurrences of 'deferredSyntaxAllowedAsLiteral' with different values
(old: {0}, new: {1})
-
-jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value for
trimDirectiveWhitespaces
-jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for
trimDirectiveWhitespaces
-jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to have multiple
occurrences of 'trimDirectiveWhitespaces' with different values (old: {0}, new:
{1})
-jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple
occurrences of 'trimDirectiveWhitespaces' with different values (old: {0}, new:
{1})
-
-# JavacErrorDetail
-jsp.error.bug48494=Unable to display JSP extract. Probably due to a JRE bug (see Tomcat
bug 48498 for details).
Deleted: trunk/src/main/java/org/apache/jasper/resources/LocalStrings_es.properties
===================================================================
--- trunk/src/main/java/org/apache/jasper/resources/LocalStrings_es.properties 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/resources/LocalStrings_es.properties 2012-09-21
14:14:07 UTC (rev 2083)
@@ -1,456 +0,0 @@
-jsp.error.compiler = No hay compilador Java disponible
-# Licensed to the Apache Software Foundation (ASF) under one or more
-# contributor license agreements. See the NOTICE file distributed with
-# this work for additional information regarding copyright ownership.
-# The ASF licenses this file to You under the Apache License, Version 2.0
-# (the "License"); you may not use this file except in compliance with
-# the License. You may obtain a copy of the License at
-#
-#
http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-# $Id: LocalStrings_es.properties 789 2008-09-22 16:52:37Z remy.maucherat(a)jboss.com $
-#
-# Default localized string information
-# Localized para Locale es_ES
-jsp.error.bad.servlet.engine = \u00A1Versi\u00F3n incorrecta del motor servlet\!
-jsp.error.no.scratch.dir = El motor JSP no tiene configurado un directorio de
trabajo.\n\
- \ A\u00F1ada "jsp.initparams\=scratchdir\=<dir-name>" \n\
- \ en el fichero servlets.properties para este contexto.
-jsp.error.bad.scratch.dir = El directorio de trabajo especificado\: {0} no es
utilizable.
-jsp.message.scratch.dir.is = El directorio de trabajo para el motor JSP es\: {0}
-jsp.message.parent_class_loader_is = El cargador de clases es\: {0}
-jsp.message.dont.modify.servlets = IMPORTANTE\: No modifique los servlets generados
-jsp.error.not.impl.comments = Error Interno\: Comments no implementado
-jsp.error.not.impl.directives = Error Interno\: Directives no implementado
-jsp.error.not.impl.declarations = Error Interno\: Declarations no implementado
-jsp.error.not.impl.expressions = Error Interno\: Expressions no implementado
-jsp.error.not.impl.scriptlets = Error Interno\: Scriptlets no implementado
-jsp.error.not.impl.usebean = Error Interno\: useBean no implementado
-jsp.error.not.impl.getp = Error Interno\: getProperty no implementado
-jsp.error.not.impl.setp = Error Interno\: setProperty no implementado
-jsp.error.not.impl.plugin = Error Interno\: plugin no implementado
-jsp.error.not.impl.forward = Error Interno\: forward no implementado
-jsp.error.not.impl.include = Error Interno\: include no implementado
-jsp.error.unavailable = JSP ha sido marcado como no disponible
-jsp.error.usebean.missing.attribute = useBean\: falta atributo id o est\u00E1 mal
digitado
-jsp.error.usebean.missing.type = useBean ({0})\: Se debe de especificar atributo class o
type\:
-jsp.error.usebean.duplicate = useBean\: Nombre de bean duplicado\: {0}
-jsp.error.usebean.prohibited.as.session = No puedo usar como bean de sesi\u00F3n {0} ya
que est\u00E1 prohibido por directiva jsp definida previamente\:
-jsp.error.usebean.not.both = useBean\: No puede especificar ambos atributos class y
beanName\:
-jsp.error.usebean.bad.type.cast = useBean ({0})\: Tipo ({1}) no es asignable desde clase
({2})
-jsp.error.invalid.scope = Valor ilegal de atributo 'scope'\: {0} (debe de ser uno
de "page", "request", "session", o "application")
-jsp.error.classname = No pude determinar el nombre de clase desde el fichero .class
-jsp.error.outputfolder = no hay carpeta de salida
-jsp.warning.bad.type = Aviso\: tipo incorrecto en archivo .class
-jsp.error.data.file.write = Error mientras escrib\u00EDa el archivo de datos
-jsp.error.page.invalid.buffer = Directiva Page\: valor incorrecto para buffer
-jsp.error.page.conflict.contenttype = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'contentType' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.contenttype = Directiva Page\: valor incorrecto para contentType
-jsp.error.page.conflict.session = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'session' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.session = Directiva Page\: valor incorrecto para session
-jsp.error.page.conflict.buffer = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'buffer'con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.buffer = Directiva Page\: valor incorrecto para b\u00FAfer
-jsp.error.page.conflict.autoflush = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'autoFlush' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.autoflush = \=Directiva Page\: valor incorrecto para autoFlush
-jsp.error.page.conflict.isthreadsafe = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'isThreadSafe' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.isthreadsafe = \=Directiva Page\: valor incorrecto para
isThreadSafe
-jsp.error.page.conflict.info = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'info' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.info = \=Directiva Page\: valor incorrecto para info
-jsp.error.page.conflict.iserrorpage = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'isErrorPage' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.iserrorpage = \=Directiva Page\: valor incorrecto para
isErrorPage
-jsp.error.page.conflict.errorpage = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'errorPage' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.conflict.language = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'language' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.tag.conflict.language = Directiva Tag\: es ilegal tener m\u00FAltiples
ocurrencias de 'language' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.language.nonjava = Directiva Page\: atributo language incorrecto
-jsp.error.tag.language.nonjava = Directiva Tag\: atributo language incorrecto
-jsp.error.page.defafteruse.language = Directiva Page\: No puedo definir lenguage tras un
scriptlet
-jsp.error.page.nomapping.language = Directiva Page\: No hay mapeado para language\:
-jsp.error.page.conflict.extends = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'extends' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.conflict.iselignored = Directiva Page\: es ilegal tener m\u00FAltiples
ocurrencias de 'isELIgnored' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.tag.conflict.iselignored = Directiva Tag\: es ilegal tener m\u00FAltiples
ocurrencias de 'isELIgnored' con valores distintos (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.iselignored = Directiva Page\: valor inv\u00E1lido para
isELIgnored
-jsp.error.tag.invalid.iselignored = Directiva Tag\: valor incorrecto para isELIgnored
-jsp.error.page.multi.pageencoding = La directiva Page no debe de tener m\u00FAltiples
ocurrencias de pageencoding
-jsp.error.tag.conflict.attr = Directiva Tag\: es ilegal tener m\u00FAltiples ocurrencias
del atributo "{0}" con valores distintos (viejo\: {1}, nuevo\: {2})
-jsp.error.tag.multi.pageencoding = La directiva Tag no debe de tener m\u00FAltiples
ocurrencias de pageencoding
-jsp.error.page.bad_b_and_a_combo = Directiva Page\: Combinaci\u00F3n ilegal de
buffer\="none" y autoFlush\="false"
-jsp.error.not.impl.taglib = Error Interno\: Tag extensions no implementado
-jsp.error.include.missing.file = No tiene argumento de nombre de fichero
-jsp.error.include.bad.file = Argumento de nombre de fichero no v\u00E1lido
-jsp.error.include.exception = No se puede incluir {0}
-jsp.error.stream.closed = Stream cerrado
-jsp.error.invalid.forward = Tag forward no v\u00E1lido
-jsp.error.unknownException = \u00A1Error no caturado\!. Deber\u00EDas de considerar el
poner una p\u00E1gina de error para avisar de los errores m\u00E1s elegantemente
-jsp.error.invalid.directive = Directiva no v\u00E1lida
-jsp.error.invalid.implicit = TLD impl\u00EDcito inv\u00E1lido para fichero de marca en
{0}
-jsp.error.invalid.implicit.version = Versi\u00F3n inv\u00E1lida de JSP definida en TLD
impl\u00EDcito para fichero de marca en {0}
-jsp.error.invalid.version = Versi\u00F3n inv\u00E1lida de JSP definida para fichero de
marca en {0}
-jsp.error.directive.istagfile = La Directiva {0} no puede usarse en archivo de tag
-jsp.error.directive.isnottagfile = La Directiva {0} s\u00F3lo se puede usar en un archivo
de tag
-jsp.error.tagfile.tld.name = El atributo "name" de la directiva tag tiene un
valor {0} mientras que el tag "name" del elemento "tag-file" en el TLD
es {1}
-jsp.error.action.istagfile = La acci\u00F3n {0} no se puede usar en un archivo tag
-jsp.error.action.isnottagfile = La acci\u00F3n {0} s\u00F3lo se puede usar en archivos
tag
-jsp.error.unterminated = Tag {0} no terminado
-jsp.error.usebean.notinsamefile = El Tag useBean debe de empezar y terminar en el mismo
archivo f\u00EDsico
-jsp.error.loadclass.taghandler = No se puede cargar la clase {0}
-jsp.error.unable.compile = No se puede compilar la clase para JSP
-jsp.error.unable.load = No se puede cargar la clase para JSP
-jsp.error.unable.rename = No se puede renombrar el archivo de clase {0} a {1}
-jsp.error.mandatory.attribute = {0}\: Falta atributo obligatorio {1}
-jsp.error.flush = Excepci\u00F3n sucedida al vaciar los datos
-jsp.engine.info = Motor Jasper JSP 2.1
-jsp.error.invalid.expression = "{0}" contiene expresiones incorrectas\: {1}
-jsp.error.invalid.attribute = {0}\: Atributo incorrecto, {1}
-jsp.error.usebean.class.notfound = Clase\: {0} no hallada
-jsp.error.file.cannot.read = No se puede leer el archivo\: {0}
-jsp.error.file.already.registered = El archivo {0} ya se ha visto, \u00BFpodr\u00EDa ser
un include recursivo?
-jsp.error.file.not.registered = Archivo {0} not visto en include
-jsp.error.quotes.unterminated = Comillas no terminadas
-jsp.error.attr.quoted = El valor del atributo deber\u00EDa ir entre comillas
-jsp.error.attr.novalue = Atributo {0} no tiene valor
-jsp.error.tag.attr.unterminated = Lista de atributos del tag no terminada
-jsp.error.param.noname = No hay nombre en el tag PARAM
-jsp.error.param.novalue = No hay valor en el tag PARAM
-jsp.error.beans.nullbean = Se ha intentado una operaci\u00F3n de bean en un objeto nulo
-jsp.error.beans.nobeaninfo = No se puede encontrar BeanInfo para el bean
''{0}'' seguramente la clase no existe
-jsp.error.beans.introspection = Una excepci\u00F3n ha tenido lugar mientras se le\u00EDa
el m\u00E9todo de lectura de la propiedad ''{0}'' en un bean del tipo
''{1}''\:\n\
- {2}
-jsp.error.beans.nomethod = No puedo encontrar un m\u00E9todo para leer la propiedad
''{0}'' en un bean del tipo ''{1}''
-jsp.error.beans.nomethod.setproperty = No puedo encontrar un m\u00E9todo para escribir la
propiedad ''{0}'' en un bean del tipo ''{2}''
-jsp.error.beans.noproperty = No puedo encontrar informaci\u00F3n de la propiedad
''{0}'' en un bean del tipo ''{1}''
-jsp.error.beans.property.conversion = No puedo convertir cadena "{0}" a clase
"{1}" para atributo "{2}"\: {3}
-jsp.error.beans.propertyeditor.notregistered = Editor de Propiedades no registrado con el
PropertyEditorManager
-jsp.error.beans.setproperty.noindexset = No puedo poner la propiedad indexada
-jsp.error.include.tag = Tag jsp\:include no v\u00E1lido
-jsp.error.include.noflush = jsp\:include necesita tener "flush\=true"
-jsp.error.include.badflush = jsp\:include page\="..." flush\="true"
es la \u00FAnica combinaci\u00F3n v\u00E1lida en JSP 1.0
-jsp.error.attempt_to_clear_flushed_buffer = Error\: Se ha intentado limpiar un buffer que
ya hab\u00EDa sido escrito
-jsp.error.overflow = Error\:Buffer de JSP desbordado
-jsp.error.paramexpected = El tag "param" era esperado con los atributos
"name" y "value" despu\u00E9s del tag "params".
-jsp.error.param.invalidUse = La acci\u00F3n jsp\:param no debe de ser usada fuera de los
elementos jsp\:include, jsp\:forward o jsp\:params
-jsp.error.params.invalidUse = jsp\:params debe de ser un hijo directo de jsp\:plugin
-jsp.error.fallback.invalidUse = jsp\:fallback debe de ser un hijo directo de jsp\:plugin
-jsp.error.namedAttribute.invalidUse = jsp\:attribute debe de ser el subelemento de una
acci\u00F3n est\u00E1ndar o de cliente
-jsp.error.jspbody.invalidUse = jsp\:body debe de ser el subelemento de una acci\u00F3n
est\u00E1ndar o de cliente
-jsp.error.closeindividualparam = El tag param necesita ser cerrado con "/>"
-jsp.error.closeparams = El tag param necesita ser cerrado con /params
-jsp.error.params.emptyBody = jsp\:params debe de contener al menos un jsp\:param anidado
-jsp.error.params.illegalChild = jsp\:params no debe de contener elementos anidados que no
sean jsp\:param
-jsp.error.plugin.notype = Tipo no declarado en jsp\:plugin
-jsp.error.plugin.badtype = Valor ilegal para atributo 'type' en jsp\:plugin\:
debe de ser 'bean' o 'applet'
-jsp.error.plugin.nocode = C\u00F3digo no declarado en jsp\:plugin
-jsp.error.ise_on_clear = Es ilegal usar clear() cuando el tama\u00F1o del buffer es cero
-jsp.error.setproperty.beanNotFound = setProperty\: Bean {0} no encontrado
-jsp.error.getproperty.beanNotFound = getProperty\: Bean {0} no encontrado
-jsp.error.setproperty.ClassNotFound = setProperty\: clase {0} no encontrada
-jsp.error.javac = Excepci\u00F3n de Javac
-jsp.error.javac.env = Entorno
-jsp.error.compilation = Error compilando fichero\: {0} {1}
-jsp.error.setproperty.invalidSyntax = setproperty\: no puedo tener valor no nulo si la
propiedad\=*
-jsp.error.setproperty.beanInfoNotFound = setproperty\: beanInfo para bean {0} no
encontrado
-jsp.error.setproperty.paramOrValue = setProperty\: O param o value pueden estar
presentes
-jsp.error.setproperty.arrayVal = setProperty\: No puede escribir en la propiedad de array
{0} a trav\u00E9s de una valor de cadena literal
-jsp.warning.keepgen = Aviso\: valor incorrecto para el initParam keepgen. Se usar\u00E1
el valor por defecto de "false"
-jsp.warning.xpoweredBy = Aviso\: valor incorrecto para el initParam xpoweredBy. Se
usar\u00E1 el valor por defecto de "false"
-jsp.warning.enablePooling = Aviso\: valor incorrecto para el initParam enablePooling. Se
usar\u00E1 el valor por defecto de "true"
-jsp.warning.invalidTagPoolSize = Aviso\: valor incorrecto para el par\u00E1metro init
llamado tagPoolSize. Se usar\u00E1 la medida por defecto de {0}
-jsp.warning.mappedFile = Aviso\: valor incorrecto para el initParam mappedFile. Se
usar\u00E1 el valor por defecto de "false"
-jsp.warning.classDebugInfo = Aviso\: valor incorrecto para el initParam classdebuginfo.
Se usar\u00E1 el valor por defecto de "false"
-jsp.warning.checkInterval = Aviso\: valor incorrecto para el initParam checkInterval. Se
usar\u00E1 el valor por defecto de "300" segundos
-jsp.warning.modificationTestInterval = Aviso\: valor incorrecto para el initParam
modificationTestInterval. Se usar\u00E1 el valor por defecto de "4" segundos
-jsp.warning.development = Aviso\: valor incorrecto para el initParam development. Se
usar\u00E1 el valor por defecto de "true"
-jsp.warning.fork = Aviso\: valor incorrecto para el initParam fork. Se usar\u00E1 el
valor por defecto de "true"
-jsp.warning.reloading = Aviso\: valor incorrecto para el initParam reloading. Se
usar\u00E1 el valor por defecto de "true"
-jsp.warning.dumpSmap = Aviso\: valor incorrecto para el initParam dumpSmap. Se usar\u00E1
el valor por defecto de "false"
-jsp.warning.genchararray = Aviso\: valor incorrecto para el initParam genStrAsCharArray.
Se usar\u00E1 el valor por defecto de "false"
-jsp.warning.suppressSmap = Aviso\: valor incorrecto para el initParam suppressSmap. Se
usar\u00E1 el valor por defecto de "false"
-jsp.warning.displaySourceFragment = Aviso\: valor incorrecto para el initParam
displaySourceFragment. Se usar\u00E1 el valor por defecto de "verdadero"
-jsp.error.badtaglib = No se puede abrir la biblioteca de tags {0}\: {1}
-jsp.error.badGetReader = No se puede crear un reader cuando el stream no tiene buffer
-jsp.warning.unknown.element.in.taglib = Elemento desconocido ({0}) en taglib
-jsp.warning.unknown.element.in.tag = Elemento desconocido ({0}) en tag
-jsp.warning.unknown.element.in.tagfile = Elemento desconocido ({0}) en tag-file
-jsp.warning.unknown.element.in.attribute = Elemento desconocido ({0}) en attribute
-jsp.warning.unknown.element.in.variable = Elemento desconocido ({0}) en variable
-jsp.warning.unknown.element.in.validator = Elemento desconocido ({0}) en validator
-jsp.warning.unknown.element.in.initParam = Elemento desconocido ({0}) en init-param de
validator
-jsp.warning.unknown.element.in.function = Elemento desconocido ({0}) en function
-jsp.error.more.than.one.taglib = M\u00E1s de una biblioteca de tags en el TLD\: {0}
-jsp.error.teiclass.instantiation = No se puede cargar la clase TagExtraInfo llamada\:
{0}
-jsp.error.non_null_tei_and_var_subelems = Tag {0} tiene uno o m\u00E1s subelementos
variable y una clase TagExtraInfo que devuelve una o m\u00E1s VariableInfo
-jsp.error.parse.error.in.TLD = Error de an\u00E1lisis en el descriptor de biblioteca de
tags\: {0}
-jsp.error.unable.to.open.TLD = No se puede abrir el descriptor de biblioteca de tags\:
{0}
-jsp.buffer.size.zero = Tama\u00F1o de buffer <\= 0
-jsp.error.file.not.found = Archivo JSP "{0}" no encontrado
-jsp.message.copyinguri = Copiando {0} en {1}
-jsp.message.htmlcomment = \n\
- Quitando comentario\: \t{0}
-jsp.message.handling_directive = \n\
- Resolviendo directiva\: {0}\t{1}
-jsp.message.handling_plugin = \n\
- Plugin\: {0}
-jsp.message.package_name_is = El Nombre del Package es\: {0}
-jsp.message.class_name_is = El Nombre de la clase es\: {0}
-jsp.message.java_file_name_is = El Nombre del Archivo Java es\: {0}
-jsp.message.class_file_name_is = El Nombre del Archivo de clase es\: {0}
-jsp.message.accepted = Acept\u00F3 {0} en {1}
-jsp.message.adding_jar = A\u00F1adiendo jar {0} a mi classpath
-jsp.message.compiling_with = Compilado con\: {0}
-jsp.message.template_text = texto plantilla
-jsp.error.missing_attribute = De acuerdo con el TLD el atributo {0} es obligatorio para
el tag {1}
-jsp.error.bad_attribute = El atributo {0} no es v\u00E1lido seg\u00FAn el TLD
especificado
-jsp.error.tld.unable_to_read = Imposible de leer TLD "{1}" desde archivo JAR
"{0}"\: {2}
-jsp.error.tld.unable_to_get_jar = Imposible obtener recurso JAR "{0}"
conteniendo TLD\: {1}
-jsp.error.tld.missing_jar = Falta recurso JAR "{0}" conteniendo TLD
-jsp.error.webxml_not_found = No puedo localizar web.xml
-jsp.cmd_line.usage = Uso\: jsptoservlet [-dd <ruta/a/DirectorioSalida>]
[-keepgenerated] <Archivos .jsp>
-jsp.message.cp_is = Classpath {0} es\: {1}
-jsp.error.unable.to_load_taghandler_class = No se puede cargar clase manejadora {0} del
tag a causa de {1}
-jsp.error.unable.to_find_method = No se puede encontrar el m\u00E9todo de escritura para
el atributo\: {0}
-jsp.error.unable.to_convert_string = No pude convertir un String a {0} para atributo {1}
-jsp.error.unable.to_introspect = No se puede hacer introspecci\u00F3n en manejador de tag
clase\: {0} a causa de {1}
-jsp.error.bad_tag = No existe el tag {0} en la biblioteca importada con prefijo {1}
-jsp.error.xml.bad_tag = No se ha definido el tag "{0}" en la biblioteca tag
asociada con uri "{1}"
-jsp.error.bad_string_Character = No puede extraer un Character desde un array de
tama\u00F1o cero
-jsp.error.bad_string_char = No puede extraer un char desde un array de tama\u00F1o cero
-jsp.warning.compiler.class.cantcreate = No puedo crear una instancia de la clase
especificada {0} de plugin del compilador debido a {1}. Se usar\u00E1 el compilador Java
de Sun.
-jsp.warning.compiler.class.notfound = No puedo encontrar una instancia de la clase {0} de
plugin de compilador. Se usar\u00E1 el compilador del Java de Sun.
-jsp.warning.compiler.path.notfound = Trayectoria del compilador especificado {0} no
encontrada. Se usar\u00E1 el PATH del sistema.
-jsp.error.jspc.uriroot_not_dir = La opci\u00F3n -uriroot debe de especificar un
directorio ya existente
-jsp.error.jspc.missingTarget = Falta target\: Debe de especificar -webapp o -uriroot o
una o m\u00E1s p\u00E1ginas JSP
-jsp.error.jspc.no_uriroot = No se ha especificado uriroot y no puede ser localizado en
los archivos JSP especificados
-jspc.implicit.uriRoot = uriRoot implicitamente puesto a "{0}"
-jspc.usage = Uso\: jspc <opciones> [--] <Archivos JSP>\n\
- donde <Archivos JSP> son\:\n\
- \ -webapp <dir> Un directorio conteniendo una web-app. Todas las\n\
- \ p\u00E1ginas jsp ser\u00E1n compiladas recursivamente\n\
- o cualquier n\u00FAmero de\n\
- \ <Archivo> Un Archivo para ser interpretado como una p\u00E1gina
jsp\n\
- y donde <opciones> incluyen\:\n\
- \ -help Muestra este mensaje de ayuda\n\
- \ -v Modo detallado\n\
- \ -d <dir> Directorio de salida\n\
- \ -l Muestra el nombre de la p\u00E1gina JSP al ocurrir un fallo\n\
- \ -s Muestra el nombre de la p\u00E1gina JSP al tener \u00E9xito\n\
- \ -p <name> Nombre del package objetivo\n\
- \ (por defecto org.apache.jsp)\n\
- \ -c <name> Nombre de la clase objetivo\n\
- \ (s\u00F3lo se aplica a la primera p\u00E1gina JSP)\n\
- \ -mapped Genera llamadas separadas a write() para cada l\u00EDnea de\n\
- \ HTML en el JSP\n\
- \ -die[\#] Genera un c\u00F3digo de retorno de error (\#) en errores\n\
- \ fatales. (por defecto 1).\n\
- \ -uribase <dir> El directorio uri de donde deben de partir las\n\
- \ compilaciones. (por defecto "/")\n\
- \ -uriroot <dir> Igual que -webapp\n\
- \ -compile Compila los servlets generados\n\
- \ -webinc <file> Crea unos mapeos parciales de servlet en el archivo\n\
- \ -webxml <file> Crea un web.xml completo en el archivo.\n\
- \ -ieplugin <clsid> Java Plugin classid para Internet Explorer\n\
- \ -classpath <path> Pasa por alto la propiedad de sistema java.class.path\n\
- \ -xpoweredBy A\u00F1ade cabecera de respuesta X-Powered-By\n\
- \ -trimSpaces Trim spaces in template text between actions, directives\n\
- \ -javaEncoding <enc> Set the encoding charset for Java classes (default
UTF-8)\n\
- \ -source <version> Set the -source argument to the compiler (default
1.4)\n\
- \ -target <version> Set the -target argument to the compiler (default 1.4)\n
-jspc.webxml.header = <?xml version\="1.0"
encoding\="ISO-8859-1"?>\n\
- \n\
- <\!DOCTYPE web-app\n\
- \ PUBLIC "-//Sun Microsystems, Inc.//DTD Web Application 2.3//EN"\n\
- \ "http\://java.sun.com/dtd/web-app_2_3.dtd">\n\
- <\!--\n\
- Creado automaticamente mediante Apache Jakarta Tomcat JspC.\n\
- -->\n\
- <web-app>\n\
- \n
-jspc.webxml.footer = \n\
- </web-app>\n\
- \n
-jspc.webinc.header = \n\
- <\!--\n\
- Creado automaticamente mediante Apache Jakarta Tomcat JspC.\n\
- Coloque este fragmento en el fichero web.xml antes de \n\
- todos los elementos\: icon, display-name, description, \n\
- distributable y context-param .\n\
- -->\n
-jspc.webinc.footer = \n\
- <\!--\n\
- Los Elementos\: session-config, mime-mapping, welcome-file-list, error-page, taglib,\n\
- resource-ref, security-constraint, login-config, security-role,\n\
- env-entry y ejb-ref deber\u00E1n de ir despu\u00E9s de este fragmento .\n\
- -->\n
-jspc.webinc.insertEnd = <\!-- Fin de mapeos de servlet JSPC -->
-jspc.webinc.insertStart = <\!-- Inicio de mapeos de servlet JSPC -->
-jspc.error.jasperException = error-el archivo ''{0}'' ha generado la
excepci\u00F3n de sint\u00E1xis siguiente\: {1}
-jspc.error.generalException = ERROR-el archivo ''{0}'' ha generado la
excepci\u00F3n general siguiente\:
-jspc.error.fileDoesNotExist = El archivo ''{0}'' utilizado como argumento
no existe.
-jspc.error.emptyWebApp = -webapp necesita un argumento de archivo
-jsp.error.library.invalid = La p\u00E1gina JSP es incorrecta de acuerdo a la biblioteca
{0}\: {1}
-jsp.error.tlvclass.instantiation = No pude cargar o instanciar clase
TagLibraryValidator\: {0}
-jsp.error.tlv.invalid.page = Mensajes de error de validaci\u00F3n desde
TagLibraryValidator para {0} in {1}
-jsp.error.tei.invalid.attributes = Mensajes de error de validaci\u00F3n desde
TagExtraInfo para {0}
-jsp.parser.sax.propertynotsupported = Propiedad SAX no soportada\: {0}
-jsp.parser.sax.propertynotrecognized = Propiedad SAX no reconocida\: {0}
-jsp.parser.sax.featurenotsupported = Caracter\u00EDstica SAX no soportada\: {0}
-jsp.parser.sax.featurenotrecognized = Caracter\u00EDstica SAX no reconocida\: {0}
-jsp.error.no.more.content = Alcanzado fin de contenido mietras se requer\u00EDa m\u00E1s
an\u00E1lisis\: \u00BFerror de anidamiento de tag?
-jsp.error.parse.xml = Error de an\u00E1lisis XML en archivo {0}
-jsp.error.parse.xml.line = Error de an\u00E1lisis XML en archivo {0}\: (l\u00EDnea {1},
col {2})
-jsp.error.parse.xml.scripting.invalid.body = El cuerpo de elemento {0} no debe de
contener elementos XML
-jsp.error.internal.tldinit = No pude inicializar TldLocationsCache\: {0}
-jsp.error.internal.filenotfound = Error Interno\: Archivo {0} no hallado
-jsp.error.internal.evaluator_not_found = Error interno\: no pude cargar evaluador de
expresiones
-jsp.error.parse.xml.invalidPublicId = PUBLIC ID incorrecta\: {0}
-jsp.error.include.flush.invalid.value = Valor incorrecto para atributo flush\: {0}
-jsp.error.unsupported.encoding = Codificaci\u00F3n no soportada\: {0}
-tld.error.variableNotAllowed = Es un error para un tag, que tiene uno o m\u00E1s
subelementos variables, el tener una clase TagExtraInfo que devuelve un objeto no nulo.
-jsp.error.tldInWebDotXmlNotFound = No pude localizar TLD {1} para URI {0} especificado en
web.xml
-jsp.error.taglibDirective.absUriCannotBeResolved = La uri absoluta\: {0} no puede
resolverse o en web.xml o el los archivos jar desplegados con esta aplicaci\u00F3n
-jsp.error.taglibDirective.missing.location = No se ha especificado ni el atributo
'uri' ni el 'tagdir'
-jsp.error.taglibDirective.both_uri_and_tagdir = Se han especificado ambos atributos
'uri' y 'tagdir'
-jsp.error.invalid.tagdir = El directorio de archivo Tag {0} no comienza con
"/WEB-INF/tags"
-jsp.error.unterminated.user.tag = Tag definido por usuario no terminado\: tag final {0}
no hallado o anidado incorrectamente
-#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
{1}
-jspx.error.templateDataNotInJspCdata = Error de Validaci\u00F3n\: El Elemento
<{0}> no puede tener datos plantilla. Los datos plantilla deben de estar
encapsulados dentro de un elemento <jsp\:text>. [JSP1.2 PFD secci\u00F3n
5.1.9]\n\
- Datos de Plantilla en error\: {1}
-#Error while processing taglib jar file {0}: {1}
-jsp.error.taglib.reserved.prefix = El prefijo taglib {0} est\u00E1 reservado
-jsp.error.invalid.javaEncoding = Codificaciones java incorrectas. Intent\u00E9 {0} y
luego {1}. Ambas fallaron.
-jsp.error.needAlternateJavaEncoding = La codificaci\u00F3n java por defecto {0} es
incorrecta en tu plataforma java. Se puede especificar una alternativa v\u00EDa
par\u00E1metro 'javaEncoding' de JspServlet.
-#Error when compiling, used for jsp line number error messages
-jsp.error.single.line.number = Ha tenido lugar un error en la l\u00EDnea\: {0} en el
archivo jsp\: {1}
-jsp.error.multiple.line.number = \n\
- \n\
- Ha tenido lugar un error entre las l\u00EDneas\: {0} y {1} en el archivo jsp\: {2}\n\
- \n
-jsp.error.java.line.number = Ha tenido lugar un error en la l\u00EDnea\: {0} en el
fichero java generado
-jsp.error.corresponding.servlet = Error de servlet generado\:\n
-jsp.error.empty.body.not.allowed = Cuerpo vac\u00EDo no permitido para {0}
-jsp.error.jspbody.required = Se debe de usar jsp\:body para especificar cuerpo tag para
{0} si se usa jsp\:attribute.
-jsp.error.jspbody.emptybody.only = El tag {0} s\u00F3lo puede tener jsp\:attribute en su
cuerpo.
-jsp.error.no.scriptlets = Los elementos de Scripting (<%\!,
<jsp\:declaration, <%\=, <jsp\:expression, <%,
<jsp\:scriptlet ) no est\u00E1n permitidos aqu\u00ED.
-jsp.error.internal.unexpected_node_type = Error Interno\: Encontrado tipo de nodo
inesperado
-jsp.error.tld.fn.invalid.signature = Sint\u00E1xis incorrecta para firma de funci\u00F3n
en TLD. Biblioteca de Tag\: {0}, Funci\u00F3n\: {1}
-jsp.error.tld.fn.duplicate.name = Nombre duplicado de funci\u00F3n {0} en biblioteca de
tag {1}
-jsp.error.tld.fn.invalid.signature.commaexpected = Sint\u00E1xis incorrecta para firma de
funci\u00F3n en TLD. Se esperaba Coma ','. Biblioteca de Tag\: {0}, Funci\u00F3n\:
{1}.
-jsp.error.tld.fn.invalid.signature.parenexpected = Sint\u00E1xis incorrecta para firma de
funci\u00F3n en TLD. Se esperaba Par\u00E9ntesis '('. Biblioteca de Tag\: {0},
Funci\u00F3n\: {1}.
-jsp.error.tld.mandatory.element.missing = Falta o est\u00E1 vac\u00EDo elemento TLD
obligatorio\: {0}
-jsp.error.dynamic.attributes.not.implemented = El tag {0} declara que acepta atributos
din\u00E1micos pero no implementa la interfaz requerida
-jsp.error.nomatching.fragment = No puedo hallar una directiva de atributo (con name\={0}
y fragment\=true) antes de la directiva de fragment.
-jsp.error.attribute.noequal = se esperaba s\u00EDmbolo igual
-jsp.error.attribute.noquote = se esperaba s\u00EDmbolo comillas
-jsp.error.attribute.unterminated = el atributo para {0} no est\u00E1 terminado
correctamente
-jsp.error.attribute.noescape = El valor de atributo {0} est\u00E1 entrecomillado con {1}
que debe de usar escape al usarse dentro del valor
-jsp.error.missing.tagInfo = El objeto TagInfo para {0} falta del TLD
-jsp.error.deferredmethodsignaturewithoutdeferredmethod = No puedo especificar firma de
m\u00E9todo si 'deferredMethod' no es 'verdadero'
-jsp.error.deferredvaluetypewithoutdeferredvalue = No puedo especificar un tipo de valor
si 'deferredValue' no es 'verdadero'
-jsp.error.deferredmethodandvalue = 'deferredValue' y 'deferredMethod' no
pueden ser ambos 'verdadero'
-jsp.error.fragmentwithtype = No puede especificar ambos atributos 'fragment' y
'type'. Si est\u00E1 presente 'fragment', 'type' se pone como
'javax.servlet.jsp.tagext.JspFragment'
-jsp.error.fragmentwithrtexprvalue = No puede especificar ambos atributos
'fragment' y 'rtexprvalue'. Si est\u00E1 presente 'fragment',
'rtexprvalue' se pone como 'true'
-jsp.error.fragmentWithDeclareOrScope = Ambos atributos 'fragment' y
'declare' o 'scope' se han especificado en la directiva variable
-jsp.error.var_and_varReader = S\u00F3lo se puede especificar uno de 'var' o
'varReader'
-jsp.error.missing_var_or_varReader = Falta atributo 'var' o 'varReader'
-jsp.warning.bad.urlpattern.propertygroup = Valor malo {0} en el subelemento url-pattern
en web.xml
-jsp.error.unknown_attribute_type = Tipo de atributo desconocido ({1}) para atributo {0}.
-jsp.error.coerce_to_type = No puedo coaccionar el valor ({2}) a tipo ({1}) para atributo
{0}.
-jsp.error.jspelement.missing.name = Falta atributo obligatorio XML-style 'name'
-jsp.error.xmlns.redefinition.notimplemented = Error interno\: Intento de redefinir
xmlns\:{0}. La redefinici\u00F3n de espacios de nombre no est\u00E1 implementada.
-jsp.error.could.not.add.taglibraries = No pude a\u00F1adir una o m\u00E1s bibliotecas.
-jsp.error.duplicate.name.jspattribute = El atributo {0} especificado en la acci\u00F3n
standard o custom tambi\u00E9n aparece como el valor del atributo name en jsp\:attribute
-jsp.error.not.in.template = {0} no permitido en una plantilla cuerpo de texto.
-jsp.error.badStandardAction = Acci\u00F3n est\u00E1ndar incorrecta
-jsp.error.xml.badStandardAction = Acci\u00F3n est\u00E1ndar incorrecta\: {0}
-jsp.error.tagdirective.badbodycontent = body-content incorrecto ({0}) en directiva tag
-jsp.error.simpletag.badbodycontent = El TLD para la clase {0} especifica un body-content
es incorrecto (JSP) para un SimpleTag.
-jsp.error.config_pagedir_encoding_mismatch = El Page-encoding especificado en
jsp-property-group ({0}) es diferente del especificado en la diectiva page ({1})
-jsp.error.prolog_pagedir_encoding_mismatch = El Page-encoding especificado en XML prolog
({0}) difiere del especificado en la directiva page ({1})
-jsp.error.prolog_config_encoding_mismatch = El Page-encoding especificado en XML prolog
({0}) difiere del especificado en jsp-property-group ({1})
-jsp.error.attribute.custom.non_rt_with_expr = Seg\u00FAn el TLD o la directiva attribute
del archivo tag, el atributo {0} no acepta expresiones
-jsp.error.attribute.standard.non_rt_with_expr = El atributo {0} de la acci\u00F3n
est\u00E1ndar {1} no acepta expresiones
-jsp.error.scripting.variable.missing_name = Imposible determinar nombre de variable de
scripting desde atributo {0}
-jasper.error.emptybodycontent.nonempty = Seg\u00FAn el TLD, el tag {0} debe de estar
vac\u00EDo, pero no lo est\u00E1
-jsp.error.tagfile.nameNotUnique = El valor de {0} y el valor de {1} en la l\u00EDnea {2}
son el mismo.
-jsp.error.tagfile.nameFrom.noAttribute = No puedo hallar una directiva attribute con un
atributo name con un valor "{0}", el valor de este atributo
name-from-attribute.
-jsp.error.tagfile.nameFrom.badAttribute = La directiva attribute (declarada en la
l\u00EDnea {1} y cuyo atributo name es "{0}", el valor de este atributo
name-from-attribute attribute) debe de ser del tipo java.lang.String, es
"required" y no un "rtexprvalue".
-jsp.error.page.noSession = No puedo acceder al \u00E1mbito de sesi\u00F3n en una
p\u00E1gina que no participa en una sesi\u00F3n
-jsp.error.usebean.noSession = Es ilegal para useBean el usar \u00E1mbito de sesi\u00F3n
cuando la p\u00E1gina JSP declara (v\u00EDa directiva de p\u00E1gina) que no participa en
sesiones
-jsp.error.xml.encodingByteOrderUnsupported = El orden de byte dado para encoding
"{0}" no est\u00E1 soportado
-jsp.error.xml.encodingDeclInvalid = Nombre de codificaci\u00F3n "{0}"
incorrecto.
-jsp.error.xml.encodingDeclRequired = Se necesita la declaraci\u00F3n encoding en la
declaraci\u00F3n de texto
-jsp.error.xml.morePseudoAttributes = se esperan m\u00E1s pseudo-atributos
-jsp.error.xml.noMorePseudoAttributes = no se permiten m\u00E1s pseudo-atributos.
-jsp.error.xml.versionInfoRequired = Se requiere la versi\u00F3n en la declaraci\u00F3n
XML.
-jsp.error.xml.xmlDeclUnterminated = La declaraci\u00F3n XML debe de terminar con
"?>".
-jsp.error.xml.reservedPITarget = La instrucci\u00F3n de procesamiento que coincide con
"[xX][mM][lL]" no est\u00E1 permitida.
-jsp.error.xml.spaceRequiredInPI = Se necesita un espacio en blanco entre la
instrucci\u00F3n de procesamiento y los datos.
-jsp.error.xml.invalidCharInContent = Un car\u00E1cter XML incorrecto (Unicode\: 0x{0}) se
hall\u00F3 en el contenido del elemento del documento.
-jsp.error.xml.spaceRequiredBeforeStandalone = Se necesita un espacio en blanco antes del
pseudo-atributo encoding en la declaraci\u00F3n XML.
-jsp.error.xml.sdDeclInvalid = El valor de declaraci\u00F3n de documento standalone debe
de ser "yes" o "no", no "{0}".
-jsp.error.xml.invalidCharInPI = Se hall\u00F3 un car\u00E1cter XML incorrecto (Unicode\:
0x{0}) en la instrucci\u00F3n de procesamiento
-jsp.error.xml.versionNotSupported = No se soporta la versi\u00F3n XML "{0}",
s\u00F3lo se soporta XML 1.0
-jsp.error.xml.pseudoAttrNameExpected = se esperaba un pseudo-atributo name.
-jsp.error.xml.expectedByte = Se esperaba byte {0} de {1}-byte de secuencia UTF-8.
-jsp.error.xml.invalidByte = Incorrecto byte {0} de {1}-byte de secuencia UTF-8.
-jsp.error.xml.operationNotSupported = La operaci\u00F3n "{0}" no est\u00E1
soportada por lector {1}.
-jsp.error.xml.invalidHighSurrogate = Surrogaci\u00F3n Alta de bits en secuencia UTF-8 no
debe de exceder 0x10, pero se hall\u00F3 0x{0}.
-jsp.error.xml.invalidASCII = El Byte "{0}" no es ASCII de 7-bit.
-jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = Se necesita espacio en blanco antes
del pseudo-atributo encoding en la declaraci\u00F3n XML.
-jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = Se necesita espacio en blanco antes
del pseudo-atributo encoding en la declaraci\u00F3n text.
-jsp.error.xml.spaceRequiredBeforeVersionInTextDecl = Se necesita espacio en blanco antes
del pseudo-atributo version en la declaraci\u00F3n text.
-jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl = Se necesita espacio en blanco antes
del pseudo-atributo version en la declaraci\u00F3n XML.
-jsp.error.xml.eqRequiredInXMLDecl = El car\u00E1cter '' \= '' debe de
serguir a "{0}" en la declaraci\u00F3n XML.
-jsp.error.xml.eqRequiredInTextDecl = El car\u00E1cter '' \= '' debe de
serguir a "{0}" en la declaraci\u00F3n text.
-jsp.error.xml.quoteRequiredInTextDecl = El valor que sigue a "{0}" en la
declaraci\u00F3n text debe de ser una cadena entre comillas.
-jsp.error.xml.quoteRequiredInXMLDecl = El valor que sigue a "{0}" en la
declaraci\u00F3n XML debe de ser un cadena entre comillas.
-jsp.error.xml.invalidCharInTextDecl = Un car\u00E1cter XML incorrecto (Unicode\: 0x{0})
se hall\u00F3 en la declaraci\u00F3n text
-jsp.error.xml.invalidCharInXMLDecl = Un car\u00E1cter XML incorrecto (Unicode\: 0x{0}) se
hall\u00F3 en la declaraci\u00F3n XML
-jsp.error.xml.closeQuoteMissingInTextDecl = Faltan las comillas de cierre en el valor que
sigue a "{0}" en la declaraci\u00F3n text.
-jsp.error.xml.closeQuoteMissingInXMLDecl = Faltan las comillas de cierre en el valor que
sigue a "{0}" en la declaraci\u00F3n XML.
-jsp.error.xml.invalidHighSurrogate = Los bits de surrogaci\u00F3n alta en secuencai UTF-8
no deben de exceder 0x10 pero se hall\u00F3 0x{0}.
-jsp.error.multiple.jsp = No puedo tener m\u00FAltiples especificaciones de
-jsp.error.jspoutput.conflict = <jsp\:output>\: ilegal tener ocurrencias
m\u00FAltiples de "{0}" con diferentes valores (viejo\: {1}, nuevo\: {2})
-jsp.error.jspoutput.doctypenamesystem = <jsp\:output>\: atributos
'doctype-root-element' y 'doctype-system' deben de aparecer juntos
-jsp.error.jspoutput.doctypepulicsystem = <jsp\:output>\: atributo
'doctype-system' debe de aparecer si aparece atributo 'doctype-public'
-jsp.error.jspoutput.nonemptybody = <jsp\:output> no debe de tener un
cuerpo
-jsp.error.jspoutput.invalidUse = <jsp\:output> no se debe de usar en
sint\u00E1xis est\u00E1ndar
-jsp.error.attributes.not.allowed = {0} no debe de tener atributos
-jsp.error.tagfile.badSuffix = Falta sufijo ".tag" en trayectoria de archivo de
tag {0}
-jsp.error.tagfile.illegalPath = Trayectoria de archivo de tag\: {0}, debe de comenzar con
"/WEB-INF/tags" o "/META-INF/tags"
-jsp.error.plugin.wrongRootElement = El nombre del elemento ra\u00EDz en {0} difiere de
{1}
-jsp.error.attribute.invalidPrefix = El prefijo de atributo {0} no se correponde con
ninguna biblioteca importada
-jsp.error.nested.jspattribute = Una acci\u00F3n est\u00E1ndar jsp\:attribute no puede
estar anidada dentro de otra acci\u00F3n est\u00E1ndar jsp\:attribute
-jsp.error.nested.jspbody = Una acci\u00F3n est\u00E1ndar jsp\:body no puede estar anidada
dentro de otra acci\u00F3n est\u00E1ndar jsp\:body o jsp\:attribute
-jsp.error.variable.either.name = O el atributo name-given o name-from-attribute deben de
ser especificados en una directiva variable
-jsp.error.variable.both.name = No se puede especificar ambos atributos name-given o
name-from-attribute en una directiva variable
-jsp.error.variable.alias = Ambos atributos o ninguno de name-from-attribute y alias
pueden ser especificados en una directiva variable
-jsp.error.attribute.null_name = Nombre de atributo nulo
-jsp.error.jsptext.badcontent = '<', cuando aparece en el cuerpo de
<jsp\:text>, debe de estar encapsulado dentro de un CDATA
-jsp.error.jsproot.version.invalid = N\u00FAmero incorrecto de versi\u00F3n\:
"{0}", debe de ser "1.2" o "2.0" o "2.1"
-jsp.error.noFunctionPrefix = La funci\u00F3n {0} debe de usarse con un prefijo cuando no
se especifica un espacio de nombres por defecto
-jsp.error.noFunction = La funci\u00F3n {0} no puede ser localizada mediante el prefijo
especificado
-jsp.error.noFunctionMethod = El m\u00E9todo "{0}" para la funci\u00F3n
"{1}" no se pudo hallar en la clase "{2}"
-jsp.error.function.classnotfound = La clase {0} especificada en el TLD para la
funci\u00F3n {1} no se puede hallar\: {2}
-jsp.error.signature.classnotfound = La clase {0} especificada en la firma del m\u00E9todo
en el TLD para la funci\u00F3n {1} no se puede hallar. {2}
-jsp.error.text.has_subelement = <jsp\:text> no debe de tener subelementos
-jsp.error.data.file.read = Error leyendo archivo "{0}"
-jsp.error.prefix.refined = Intento de redefinir el prefijo {0} por {1}, cuando ya estaba
definido como {2} en el \u00E1mbito en curso.
-jsp.error.nested_jsproot = <jsp\:root> anidado
-jsp.error.unbalanced.endtag = El tgag final "</{0}" est\u00E1
desequilibrado
-jsp.error.invalid.bean = El valor el atributo de clsae useBean {0} es inv\u00E1lido.
-jsp.error.prefix.use_before_dcl = El prefijo {0} especificado en esta directiva de marca
ha sido usado previamente mediante un fichero de acci\u00F3n {1} l\u00EDnea {2}.
-jsp.exception = Ha sucedido una excepci\u00F3n al procesar la p\u00E1gina JSP {0} en
l\u00EDnea {1}
-jsp.error.el.template.deferred = \#{..} no est\u00E1 permitido en texto de plantilla
-jsp.error.el.parse = {0} \: {1}
-jsp.error.page.invalid.deferredsyntaxallowedasliteral = Directiva de p\u00E1gina\: valor
inv\u00E1lido para deferredSyntaxAllowedAsLiteral
-jsp.error.tag.invalid.deferredsyntaxallowedasliteral = Directiva de marca\: valor
inv\u00E1lido para deferredSyntaxAllowedAsLiteral
-jsp.error.page.conflict.deferredsyntaxallowedasliteral = Directiva de p\u00E1gina\: es
ilegal tener m\u00FAltiples ocurrencias de 'deferredSyntaxAllowedAsLiteral' con
diferentes valores (viejo\: {0}, nuevo\: {1})
-jsp.error.tag.conflict.deferredsyntaxallowedasliteral = Directiva de marca\: es ilegal
tener m\u00FAltiples ocurrencias de 'deferredSyntaxAllowedAsLiteral' con
diferentes valores (viejo\: {0}, nuevo\: {1})
-jsp.error.page.invalid.trimdirectivewhitespaces = Directiva de p\u00E1gina\: valor
inv\u00E1lido para trimDirectiveWhitespaces
-jsp.error.tag.invalid.trimdirectivewhitespaces = Directiva de marca\: valor inv\u00E1lido
para trimDirectiveWhitespaces
-jsp.error.page.conflict.trimdirectivewhitespaces = Directiva de p\u00E1gina\: es ilegal
tener m\u00FAltiples ocurrencias de 'trimDirectivewhitespaces' con diferentes
valores (viejo\: {0}, nuevo\: {1})
-jsp.error.tag.conflict.trimdirectivewhitespaces = Directiva de marca\: es ilegal tener
m\u00FAltiples ocurrencias de 'trimDirectivewhitespaces' con diferentes valores
(viejo\: {0}, nuevo\: {1})
Deleted: trunk/src/main/java/org/apache/jasper/resources/LocalStrings_fr.properties
===================================================================
--- trunk/src/main/java/org/apache/jasper/resources/LocalStrings_fr.properties 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/resources/LocalStrings_fr.properties 2012-09-21
14:14:07 UTC (rev 2083)
@@ -1,305 +0,0 @@
-# $Id: LocalStrings_fr.properties 520 2008-03-17 21:29:47Z jfrederic.clere(a)jboss.com $
-#
-# Default localized string information
-# Localized this the Default Locale as is fr_FR
-
-jsp.error.bad.servlet.engine=Version de moteur de servlet incorrecte!
-jsp.error.no.scratch.dir=Le moteur de JSP engine n''est pas configur� avec un
r�pertoire de travail.\
-\n Merci d''ajouter \"jsp.initparams=scratchdir=<dir-name>\" \
-\n dans le fichier "servlets.properties" de ce contexte.
-jsp.error.bad.scratch.dir=Le param�tre "scratchDir" que vous avez sp�cifi�: {0}
est inutilisable.
-jsp.message.scratch.dir.is=Le r�pertoire de travail (scratch dir) pour le moteur de JSP
est: {0}
-jsp.message.parent_class_loader_is=Le chargeur de classe parent (class loader) est: {0}
-jsp.message.dont.modify.servlets=IMPORTANT: Ne pas modifier les servlets g�n�r�es
-jsp.error.not.impl.comments=Erreur interne: Commentaires non impl�ment�s
-jsp.error.not.impl.directives=Erreur interne: Directives non impl�ment�es
-jsp.error.not.impl.declarations=Erreur interne: Declarations non impl�ment�es
-jsp.error.not.impl.expressions=Erreur interne: Expressions non impl�ment�es
-jsp.error.not.impl.scriptlets=Erreur interne: Scriptlets non impl�ment�s
-jsp.error.not.impl.usebean=Erreur interne: useBean non impl�ment�
-jsp.error.not.impl.getp=Erreur interne: getProperty non impl�ment�
-jsp.error.not.impl.setp=Erreur interne: setProperty non impl�ment�
-jsp.error.not.impl.plugin=Erreur interne: plugin non impl�ment�
-jsp.error.not.impl.forward=Erreur interne: forward non impl�ment�
-jsp.error.not.impl.include=Erreur interne: include non impl�ment�
-jsp.error.unavailable=La JSP a �t� marqu�e comme non disponible
-jsp.error.usebean.missing.attribute=useBean: l''identificateur
d''attribut (id attribute) est manquant ou mal orthographi�
-jsp.error.usebean.missing.type=useBean ({0}): La classe ou le type d''attribut
doit �tre\
-sp�cifi�:
-jsp.error.usebean.duplicate=useBean: Nom de bean dupliqu�: {0}
-jsp.error.usebean.prohibited.as.session=Impossible d''utiliser comme bean de
session {0} car c''est interdit\
-par la directive jsp d�finie pr�c�demment:
-jsp.error.usebean.not.both=useBean: Impossible de sp�cifier � la fois la classe et
l''attribut beanName:
-jsp.error.usebean.bad.type.cast=useBean ({0}): Le type ({1}) n''est pas
assignable depuis la classe ({2})
-jsp.error.classname=Impossible de d�terminer le nom de classe d''apr�s le fichier
.class
-jsp.warning.bad.type=Attention: mauvais type dans le fichier .class
-jsp.error.data.file.write=Erreur lors de l''�criture du fichier de donn�es
-#Directive de Page: valeur incorrecte pour pageEncoding
-jsp.error.page.invalid.contenttype=Directive de Page: valeur incorrecte pour contentType
-jsp.error.page.invalid.session=Directive de Page: valeur incorrecte pour session
-jsp.error.page.invalid.buffer=Directive de Page: valeur incorrecte pour
"buffer"
-jsp.error.page.invalid.autoflush=Directive de Page: valeur incorrecte pour autoFlush
-jsp.error.page.invalid.isthreadsafe=Directive de Page: valeur incorrecte pour
isThreadSafe
-jsp.error.page.invalid.info=Directive de Page: valeur incorrecte pour info
-jsp.error.page.invalid.iserrorpage=Directive de Page: valeur incorrecte pour isErrorPage
-jsp.error.page.defafteruse.language=Directive de Page: on ne peut d�finir language apr�s
un scriptlet
-jsp.error.page.nomapping.language=Directive de Page: Pas de correspondance pour language:
-jsp.error.page.bad_b_and_a_combo=Directive de Page: combinaison ill�gale de
buffer=\"none\" && autoFlush=\"false\"
-jsp.error.not.impl.taglib=Internal error: Tag extensions non impl�ment�s
-jsp.error.include.missing.file=l''argument fichier (file) pour
l''inclusion (include) est absent
-jsp.error.include.bad.file=Mauvais argument fichier (file) pour l''inclusion
(include)
-jsp.error.include.exception=Impossible d''inclure (include) {0}
-jsp.error.stream.closed=Flux ferm�
-jsp.error.invalid.forward=Tag forward incorrect
-jsp.error.unknownException=Erreur non trait�e! Vous devriez penser � utiliser une page
d''erreur \
-pour rapporter ce type d''erreur plus �l�gamment
-jsp.error.invalid.directive=Directive incorrecte
-jsp.error.directive.istagfile=La directive {0} ne peut �tre utilis�e dans un fichier tag
-jsp.error.directive.isnottagfile=La directive {0} ne peut �tre utilis�e que dans un
fichier tag
-jsp.error.tagfile.tld.name=L''attribut \"name\" de la directive tag
contient la valeur {0} alors que le tag \"name\" de l''�l�ment
\"tag-file\" dans le TLD est {1}
-jsp.error.action.istagfile=L''action {0} ne peut �tre utilis�e dans un fichier
tag
-jsp.error.action.isnottagfile=L''action {0} ne peut �tre utilis�e que dans un
fichier tag
-jsp.error.unterminated=Tag {0} non termin�
-jsp.error.usebean.notinsamefile=le tag useBean doit commenc� et finir dans le m�me
fichier physique
-jsp.error.loadclass.taghandler=Impossible de charger la classe {0}
-jsp.error.unable.compile=Impossible de compiler la classe pour la JSP
-jsp.error.unable.load=Impossible de charger la classe pour la JSP
-jsp.error.unable.rename=Impossible de renommer le fichier classe de {0} vers {1}
-jsp.error.mandatory.attribute={0}: L''attribut obligatoire {1} est manquant
-jsp.engine.info=Moteur Jasper JSP 2.0
-jsp.error.invalid.expression="{0}" contient d''incorrecte(s)
expression(s): {1}
-jsp.error.invalid.attribute={0}: Attribut incorrect: {1}
-jsp.error.usebean.class.notfound=Classe: {0} non trouv�e
-jsp.error.file.cannot.read=Impossible de lire le fichier: {0}
-jsp.error.file.already.registered=Inclusion r�cursive du fichier {0}
-jsp.error.file.not.registered=Le fichier {0} n''appara�t pas dans
l''inclusion (include)
-jsp.error.quotes.unterminated=guillemets non termin�s
-jsp.error.attr.quoted=La valeur de l''attribute doit �tre entre guillemets
-jsp.error.attr.novalue=L''attribute {0} n''a pas de valeur
-jsp.error.tag.attr.unterminated=Liste de tag d''attribut non termin�e
-jsp.error.param.noname=Pas de nom dans le tag PARAM
-jsp.error.param.novalue=Pas de valeur dans le tag PARAM
-jsp.error.beans.nullbean=Tentative d''op�ration bean sur un objet nul.
-jsp.error.beans.nobeaninfo=Pas d''information bean (BeanInfo) pour le bean de
type ''{0}'' n''a pu �tre trouv�e, la classe n''existe
probablement pas.
-jsp.error.beans.introspection=Une exception s''est produite lors de
l''introspection de la m�thode read de la propri�t� ''{0}'' dans
le bean de type ''{1}'':\n{2}
-jsp.error.beans.nomethod=Impossible de trouver une m�thode pour lire la propri�t�
''{0}'' dans le bean de type ''{1}''
-jsp.error.beans.nomethod.setproperty=Impossible de trouver une m�thode pour mettre � jour
la propri�t� ''{0}'' de type ''{1}''dans le bean de type
''{2}''
-jsp.error.beans.noproperty==Impossible de trouver de l''information sur la
propri�t� ''{0}'' dans le bean de type ''{1}''
-jsp.error.beans.setproperty.noindexset=Impossible de renseigner la propri�t� ind�x�e
-jsp.error.include.tag=Tag jsp:include incorrect
-jsp.error.include.noflush=jsp:include doit avoir \"flush=true\"
-jsp.error.include.badflush=jsp:include page=\"...\" flush=\"true\"
est la seule combinaison valide dans JSP 1.0
-jsp.error.attempt_to_clear_flushed_buffer=Erreur: Tentative d''effacement
d''un tampon qui a d�j� �t� vidang� (flush)
-jsp.error.overflow=Erreur: D�passement de capacit� du tampon JSP
-jsp.error.paramexpected=Le tag \"param\" est attendu avec les attributs
\"name\" et \"value\" apr�s le tag \"params\".
-jsp.error.closeindividualparam=Le tag param doit �tre ferm� avec \"/>\"
-jsp.error.closeparams=Le tag param tag doit �tre ferm� avec /params
-jsp.error.plugin.notype=type non d�clar� dans jsp:plugin
-jsp.error.plugin.nocode=code non d�clar� dans jsp:plugin
-jsp.error.ise_on_clear=Il est interdit d''utiliser clear() quand la taille de
tampon== 0
-jsp.error.setproperty.beanNotFound=setProperty: le Bean {0} est introuvable
-jsp.error.getproperty.beanNotFound=getProperty: le Bean {0} est introuvable
-jsp.error.setproperty.ClassNotFound=setProperty: la Classe {0} est introuvable
-jsp.error.setproperty.invalidSyntax=setProperty: On ne peut avoir de valeur non nulle
quand property=*
-jsp.error.setproperty.beanInfoNotFound=setproperty: beanInfo pour le bean {0} est
introuvable
-jsp.error.setproperty.paramOrValue=setProperty: param ou value doit �tre pr�sent
-jsp.error.setproperty.arrayVal=setProperty: on ne peut renseigner les array property {0}
au travers d''une valeur cha�ne constante (string constant value)
-jsp.warning.keepgen=Attention: Valeur incorrecte pour le initParam keepgenerated.
Utilisation de la valeur par d�faut \"false\"
-jsp.warning.enablePooling=Attention: Valeur incorrecte pour le initParam enablePooling.
Utilisation de la valeur par d�faut \"true\"
-jsp.warning.mappedFile=Attention: Valeur incorrecte pour le initParam mappedFile.
Utilisation de la valeur par d�faut \"false\"
-jsp.warning.sendErrToClient=Attention: Valeur incorrecte pour le initParam
sendErrToClient. Utilisation de la valeur par d�faut \"false\"
-jsp.warning.classDebugInfo=Attention: Valeur incorrecte pour le initParam classdebuginfo.
Utilisation de la valeur par d�faut \"false\"
-jsp.warning.checkInterval=Attention: Valeur incorrecte pour le initParam checkInterval.
Utilisation de la valeur par d�faut \"300\" secondes
-jsp.warning.development=Attention: Valeur incorrecte pour le initParam development.
Utilisation de la valeur par d�faut \"true\"
-jsp.warning.reloading=Attention: Valeur incorrecte pour le initParam reloading.
Utilisation de la valeur par d�faut \"true\"
-jsp.warning.reloading=
-jsp.error.badtaglib=Impossible d''ouvrir le taglibrary {0} : {1}
-jsp.error.badGetReader=Impossible de cr�er un lecteur (reader) quand le flux
n''utilse pas des tampons (not buffered)
-jsp.warning.unknown.element.in.TLD=Attention: El�ment inconnu {0} dans le TLD
-jsp.warning.unknown.element.in.tag=Attention: El�ment inconnu {0} dans le tag
-jsp.warning.unknown.element.in.tagfile=Attention: El?ment inconnu {0} dans le tag-file
-jsp.warning.unknown.element.in.attribute=Attention: El�ment inconnu {0} dans
l''attribute
-jsp.error.more.than.one.taglib=plus d''un taglib dans le TLD: {0}
-jsp.error.teiclass.instantiation=Impossible de charger ou d''instancier la classe
TagExtraInfo: {0}
-jsp.error.non_null_tei_and_var_subelems=Le tag {0} poss�de une ou plusieurs variables
subelements et une classe TagExtraInfo qui retourne une ou plusieurs VariableInfo
-jsp.error.parse.error.in.TLD=Erreur d''�valuation (parse) dans le descripteur de
librairie de tag (TLD): {0}
-jsp.error.unable.to.open.TLD=Impossible d''ouvrir le descripteur de librairie de
tag (TLD): {0}
-jsp.buffer.size.zero=Taille du tampon <= 0
-jsp.error.file.not.found=Le fichier \"{0}\" n''a pas �t� trouv�
-jsp.message.copyinguri=Copie de {0} dans {1}
-jsp.message.htmlcomment=\nEffacement des commentaires: \t{0}
-jsp.message.handling_directive=\nDirective de gestion (handling): {0}\t{1}
-jsp.message.handling_plugin=\nPlugin: {0}
-jsp.message.package_name_is=Le nom de package est: {0}
-jsp.message.class_name_is=Le nom de classe est: {0}
-jsp.message.java_file_name_is=Le nom de fichier Java est: {0}
-jsp.message.class_file_name_is=Le nom de fichier Class est: {0}
-jsp.message.accepted=Accept� {0} � {1}
-jsp.message.adding_jar=Ajout du jar {0} � mon classpath
-jsp.message.compiling_with=Compilation avec: {0}
-jsp.message.template_text=texte template
-jsp.error.missing_attribute=D''apr�s le TLD l''attribut {0} est
obligatoire pour le tag {1}
-jsp.error.bad_attribute=L''attribut {0} est incorrect pour le tag {1}
d''apr�s la TLD indiqu�e
-jsp.error.webxml_not_found=Impossible de localiser le fichier web.xml
-jsp.cmd_line.usage=Usage: jsptoservlet [-dd <path/to/outputDirectory>]
[-keepgenerated] \
-<.jsp files>
-jsp.message.cp_is=Le Classpath {0} est: {1}
-jsp.error.unable.to_load_taghandler_class=Impossible de charger la classe gestionnaire de
tag {0} car {1}
-jsp.error.unable.to_find_method=Impossible de trouver une m�thode de mise � jour pour
l''attribut: {0}
-jsp.error.unable.to_convert_string=Impossible de convertir une cha�ne vers {0} pour
l''attribut {1}
-jsp.error.unable.to_introspect=Impossible d''introspecter la classe gestionnaire
de tag : {0} car {1}
-jsp.error.bad_tag=Aucun tag {0} dans la librairie de tag import�e avec le pr�fixe {1}
-jsp.error.bad_string_Character=Impossible d''extraire un caract�re depuis un
tableau vide
-jsp.error.bad_string_char=Impossible d''extraire un caract�re depuis un tableau
vide
-jsp.warning.compiler.class.cantcreate=Impossible de cr�er une instance de classe plugin
pour le compilateur indiqu� {0} due to {1}. Utilisation par d�faut du Compilateur Java
Sun.
-jsp.warning.compiler.class.notfound=La classe plugin de compilateur {0} est introuvable.
Utilisation par d�faut du Compilateur Java Sun.
-jsp.warning.compiler.path.notfound=le chemin de compilateur indiqu� {0} est introuvable.
Utilisation par d�faut du chemin syst�me (system PATH).
-jsp.error.jspc.uriroot_not_dir=L''option -uriroot doit indiqu� un r�pertoire d�j�
existant
-jspc.implicit.uriRoot=uriRoot r�gl� implicitement � "{0}"
-jspc.usage=Usage: jspc <options> [--] <fichiers jsp>\n\
-o� les fichiers jsp sont n''importe quel nombre de:\n\
-\ <file> Un fichier � �valuer (parser) comme page jsp\n\
-\ -webapp <dir> Un r�pertoire contenant une application web, toutes les pages
jsp\n\
-\ seront r�cursivement �valu�es\n\
-o� les options comprennet:\n\
-\ -q Mode silencieux (identique � -v0)\n\
-\ -v[#] Mode bavard (Le nombre optionnel indique le niveau, 2 par d�faut)\n\
-\ -d <dir> Dossier de sortie\n\
-\ -dd <dir> Dossier de sortie literal. (Les dossiers de paquets ne seront pas
construits)\n\
-\ -l Sortie du nom la page JSP en cas d''�chec\n\
-\ -s Sortie du nom la page JSP en cas de succ�s\n\
-\ -p <name> Nom du paquet cible\n\
-\ -c <name> Nom d'un nom de classe cible\n\
-\ (s''applique seulement � la premi�re page JSP)\n\
-\ -mapped G�n�re des appels � write() s�par�s pour chaque ligne HTML dans la
JSP\n\
-\ -die[#] G�n�re un code d''erreur de retour (#) en cas d''erreurs
fatales.\n\
-\ Si le nombre est absent ou non num�rique, le d�faut est 1.\n\
-\ -uribase <dir> Le r�pertoire uri de compilations relatif\n\
-\ (Par d�faut "/")\n\
-\ -uriroot <dir> The r�pertoire racine contre lequel les fichiers seront
r�solus\n\
-\ , (Par d�faut le r�pertoire depuis lequel jspc est appel�)\n\
-\ -webinc <file> Cr�ation d''association partielle de servlet pour
l''option -webapp.\n\
-\ -webxml <file> Cr�ation d''un fichier web.xml complet pour
l''option -webapp.\n\
-\ -ieplugin <clsid> Le classid du Plugin Java Plugin pour Internet Explorer\n\
-\ -sax2 <driverclassname> Le nom de classe du Driver SAX 2.0 � utiliser\n\
-\ -trimSpaces Trim spaces in template text between actions, directives\n\
-\ -javaEncoding <enc> Set the encoding charset for Java classes (default
UTF-8)\n\
-\ -source <version> Set the -source argument to the compiler (default 1.4)\n\
-\ -target <version> Set the -target argument to the compiler (default 1.4)\n\
-
-jspc.webxml.header=<?xml version="1.0"
encoding="ISO-8859-1"?>\n\
-\n\
-<!DOCTYPE web-app\n\
-\ PUBLIC "-//Sun Microsystems, Inc.//DTD Web Application 2.3//EN"\n\
-\ "http://java.sun.com/dtd/web-app_2_3.dtd">\n\
-<!--\n\
-Cr�er automatiquement par le JspC Apache Jakarta Tomcat.\n\
--->\n\
-<web-app>\n\
-\n
-jspc.webxml.footer=\n\
-</web-app>\n\
-\n
-jspc.webinc.header=\n\
-<!--\n\
-Cr�er automatiquement par le JspC Apache Jakarta Tomcat.\n\
-Placez ce fragment dans le fichier web.xml avant all icon, display-name,\n\
-description, distributable, and context-param elements.\n\
--->\n
-jspc.webinc.footer=\n\
-<!--\n\
-All session-config, mime-mapping, welcome-file-list, error-page, taglib,\n\
-resource-ref, security-constraint, login-config, security-role,\n\
-env-entry, and ejb-ref elements should follow this fragment.\n\
--->\n
-jspc.error.jasperException=erreur-le fichier ''{0}'' a g�n�r�
l''exception d''�valuation suivante: {1}
-jspc.error.generalException=ERREUR-le fichier ''{0}'' a g�n�r�
l''exception g�n�rale suivante:
-jspc.error.fileDoesNotExist=L''argument fichier ''{0}''
n''existe pas
-jspc.error.emptyWebApp=-webapp n�cessite � sa suite un argument fichier
-jsp.error.library.invalid=La page JSP page est incorrecte d''apr�s la librairie
{0}: {1}
-jsp.error.tlvclass.instantiation=Impossible de charger ou d''instancier la classe
TagLibraryValidator: {0}
-jsp.error.tlv.invalid.page=Message d''erreurs de validation provenant du
TagLibraryValidator pour {0} en {1}
-jsp.error.tei.invalid.attributes=Message d''erreurs de validation provenant du
TagExtraInfo pour {0}
-jsp.parser.sax.propertynotsupported=Propri�t� SAX non support�e: {0}
-jsp.parser.sax.propertynotrecognized=Propri�t� SAX non reconnue: {0}
-jsp.parser.sax.featurenotsupported=Fonctionnalit� SAX non support�e: {0}
-jsp.parser.sax.featurenotrecognized=Fonctionnalit� SAX non reconnue: {0}
-jsp.error.no.more.content=Fin de contenu alors que l''�valution n''�tait
pas termin�e: erreur de tags imbriqu�s?
-jsp.error.parse.xml=Erreur d''�valuation XML sur le fichier {0}
-jsp.error.parse.xml.line=Erreur d''�valuation XML sur le fichier {0}: (ligne
{1}, col {2})
-jsp.error.parse.xml.scripting.invalid.body=Le corps de l''�l�ment {0} ne doit
contenir aucun �l�ments XML
-jsp.error.internal.tldinit=Exception lors de l'initialisation de TldLocationsCache:
{0}
-jsp.error.internal.filenotfound=Erreur interne: Fichier {0} introuvable
-jsp.error.internal.evaluator_not_found=Erreur interne: Impossible de charger
l''�valuateur d''expression
-jsp.error.parse.xml.invalidPublicId=PUBLIC ID invalide: {0}
-jsp.error.include.flush.invalid.value=Valeur incorrecte pour l''attribut flush:
{0}
-jsp.error.unsupported.encoding=Encodage non support�: {0}
-jsp.warning.unknown.element.in.variable=Attention: Element inconnu {0} dans la variable
-tld.error.variableNotAllowed=Ceci est une erreur pour le tag qui poss�de une ou plusieurs
variables subelements pour avoir une classe TagExtraInfo qui retourne un objet non-nul.
-jsp.error.tldInWebDotXmlNotFound=Ne peut trouver le TLD {1} pour l''URI {0}
indiqu�e dans le fichier web.xml
-jsp.error.taglibDirective.absUriCannotBeResolved=L''uri absolue: {0} ne peut �tre
r�solu dans le fichier web.xml ou dans les fichiers jar d�ploy�s avec cette application
-jsp.error.taglibDirective.missing.location=Ni l''uri' ni l''attribut
'tagdir' n''ont �t� indiqu�s dans la directive taglib
-jsp.error.invalid.tagdir=Le r�pertoire du fichier Tag {0} ne commence pas par
\"/WEB-INF/tags\"
-jsp.error.unterminated.user.tag=Tag user-defined non termin�: Le tag de fermeture {0} est
introuvable found ou incorrectement imbriqu�
-#jspx.error.templateDataNotInJspCdata=Erreur de validation: l''�l�ment
<{0}> ne peut avoir de donn�es template. Les donn�es Template doivent �tre
encapsul�es � l''int�rieur d''un �l�ment <jsp:cdata>.
[JSP1.2 PFD section 5.1.9]\nDonn�e Template en erreur: {1}
-jspx.error.templateDataNotInJspCdata=Erreur de validation: l''�l�ment
<{0}> ne peut avoir de donn�es template. Les donn�es Template doivent �tre
encapsul�es � l''int�rieur d''un �l�ment <jsp:text>. [JSP1.2
PFD section 5.1.9]\nDonn�e Template en erreur: {1}
-#Erreur lors du traitement du fichier jar de la taglib {0}: {1}
-jsp.error.taglib.reserved.prefix=Le pr�fixe taglib {0} est r�serv�
-jsp.error.invalid.javaEncoding=Encodage java incorrect. Essai de {0} puis de {1}. Les
deux ont �chou�.
-jsp.error.needAlternateJavaEncoding=L''encodage java par d�faut {0} est incorrect
sur votre environnement java. Une alternative peut �tre indiqu�e via le param�tre
'javaEncoding' de la JspServlet.
-#Erreur lors de la compilation, utilis� pour la ligne jsp des messages d''erreur
-jsp.error.single.line.number=Une erreur s''est produite � la ligne: {0} dans le
fichier jsp: {1}
-jsp.error.multiple.line.number=\n\nUne erreur s''est produite entre les lignes:
{0} et {1} dans le fichier jsp: {2}\n\n
-jsp.error.corresponding.servlet=Erreur de servlet g�n�r�e:\n
-jsp.error.empty.body.not.allowed=Un corps vide n'est pas autoris� pour {0}
-jsp.error.jspbody.required=Doit utiliser jsp:body pour indiqu� le corps de tag body de
{0} si jsp:attribute est utilis�.
-jsp.error.jspbody.emptybody.only=Le tag {0} ne peut avoir que jsp:attribute dans son
corps.
-jsp.error.no.scriptlets=Les �l�ments de Scripting ( <%!, <jsp:declaration, <%=,
<jsp:expression, <%, <jsp:scriptlet ) ne sont pas autoris�s ici.
-jsp.error.internal.unexpected_node_type=Erreur Interne: Type de node inattendu rencontr�
-jsp.error.tld.fn.invalid.signature=Synthaxe invalide pour la signature de fonction dans
la TLD. Librairie de Tag : {0}, Fonction: {1}
-jsp.error.tld.fn.invalid.signature.classnotfound=Synthaxe invalide pour la signature de
fonction dans la TLD. Classe introuvable: ${0}. Librairie de Tag: {1}, Fonction: {2}.
-jsp.error.tld.fn.invalid.signature.commaexpected=Synthaxe invalide pour la signature de
fonction dans la TLD. Virgule ',' attendue. Librairie de Tag: {0}, Fonction:
{1}.
-jsp.error.tld.fn.invalid.signature.parenexpected=Synthaxe invalide pour la signature de
fonction dans la TLD. Parenth�se '(' attendue. Librairie de Tag: {0}, Fonction:
{1}.
-jsp.error.dynamic.attributes.not.implemented=Le tag {0} indique qu''il accepte
des attributs dynamics mais n''impl�mente pas l''interface requise
-jsp.error.nomatching.fragment=Ne peut trouver une directive attribut (avec pour nom={0}
et fragment=true) avant la directive fragment.
-jsp.error.attribute.noequal=Symbole �gal (equal) attendu
-jsp.error.attribute.noquote=Symbole guillemet (quote) attendu
-jsp.error.attribute.unterminated=L''attribut pour {0} n''est pas
correctement termin�
-jsp.error.missing.tagInfo=L''objet TagInfo de {0} est absent de la TLD
-jsp.error.fragmentwithtype=On ne peut indiquer � la fois les attributs 'fragment'
et 'type'. Si 'fragment' est pr�sent, 'type' est fix� comme
'javax.servlet.jsp.tagext.JspFragment'
-jsp.error.fragmentwithrtexprvalue=On ne peut indiquer � la fois les attributs
'fragment' et 'rtexprvalue'. Si 'fragment' est pr�sent,
'rtexprvalue' est fix� � 'true'
-jsp.error.fragmentWithDeclareOrScope=Les attributs 'fragment' et
'declare' ou 'scope' sont indiqu�s dans la directive variable
-jsp.error.var_and_varReader=A la fois 'var' et 'varReader' sont indiqu�s
-jsp.warning.bad.urlpattern.propertygroup=Mauvaise valeur {0} dans le sous-�l�ment
(subelement) url-pattern du fichier web.xml
-jsp.error.unknown_attribute_type=Type d''attribut inconnu ({1}) pour
l''attribut {0}.
-jsp.error.jspelement.missing.name=L''attribut obligatoire 'name' est
absent de jsp:element
-jsp.error.xmlns.redefinition.notimplemented=Erreur Interne: Tentative de red�finition de
xmlns:{0}. La red�finition des domaines de noms (namespaces) n''est pas
impl�ment�e.
-jsp.error.could.not.add.taglibraries=Impossible d''ajouter une ou plusieurs
librairies de tag.
-jsp.error.duplicate.name.jspattribute=L''attribut {0} indiqu� dans
l''action standard ou sp�cifique (custom) apparait aussi comme valeur de
l''attribut de nom dans le jsp:attribute inclus
-jsp.error.not.in.template={0} n''est pas autoris� dans le corps de texte de
template.
-jsp.error.badStandardAction=L''action n''est pas reconnue comme une
action standard.
-jsp.error.tagdirective.badbodycontent=Contenu de corps (body-content) ({0}) invalide dans
la directive tag
-jsp.error.config_pagedir_encoding_mismatch=L''encode de page (Page-encoding)
indiqu� dans le jsp-property-group ({0}) est diff�rent de celui indiqu� dans la directive
de page ({1})
-jsp.error.prolog_pagedir_encoding_mismatch=
-jsp.error.prolog_config_encoding_mismatch=
-jsp.error.attribute.custom.non_rt_with_expr=D''apr�s la TLD, l''attribut
{0} n''accepte aucune expression
-jsp.error.scripting.variable.missing_name=Incapable de d�terminer le nom de variable
scripting d''apr�s l''attribut {0}
-jasper.error.emptybodycontent.nonempty=D''apr�s la TLD, le tag {0} doit �tre
vide, mais ne l''est pas
-jsp.error.tagfile.nameNotUnique=
-jsp.error.tagfile.nameFrom.noAttribute=
-jsp.error.tagfile.nameFrom.badAttribute=
-jsp.error.useBean.noSession=Il est ill�gal pour useBean d''utiliser une port�e de
session (session scope) quand la page JSP indique (via la directive de page)
qu''elle ne participe pas aux sessions
-jsp.error.attributes.not.allowed = {0} ne doit avoir aucun attribut
-jsp.error.nested.jspattribute=
-jsp.error.nested.jspbody=
-jsp.error.variable.either.name=
-jsp.error.variable.both.name=
-jsp.error.variable.alias=
-jsp.error.jsptext.badcontent=
-jsp.error.prefix.refined=
-jsp.error.jspoutput.conflict=
-jsp.error.jspoutput.doctypenamesystem=
-jsp.error.jspoutput.doctypepulicsystem=
-jsp.error.jspoutput.nonemptybody=
-jsp.error.jspoutput.invalidUse=
-jsp.error.invalid.bean=
Deleted: trunk/src/main/java/org/apache/jasper/resources/LocalStrings_ja.properties
===================================================================
--- trunk/src/main/java/org/apache/jasper/resources/LocalStrings_ja.properties 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/resources/LocalStrings_ja.properties 2012-09-21
14:14:07 UTC (rev 2083)
@@ -1,407 +0,0 @@
-# $Id: LocalStrings_ja.properties 520 2008-03-17 21:29:47Z jfrederic.clere(a)jboss.com $
-#
-# Default localized string information
-# Localized this the Default Locale as is ja_JP
-
-jsp.error.bad.servlet.engine=\u30b5\u30fc\u30d6\u30ec\u30c3\u30c8\u30a8\u30f3\u30b8\u30f3\u306e\u30d0\u30fc\u30b8\u30e7\u30f3\u304c\u6b63\u3057\u304f\u3042\u308a\u307e\u305b\u3093
-jsp.error.no.scratch.dir=JSP\u30a8\u30f3\u30b8\u30f3\u306b\u30c7\u30d5\u30a9\u30eb\u30c8\u306escratchDir\u304c\u8a2d\u5b9a\u3055\u308c\u3066\u3044\u307e\u305b\u3093\u3002\
-\n
\u3053\u306e\u30b3\u30f3\u30c6\u30ad\u30b9\u30c8\u306eservlets.properties\u30d5\u30a1\u30a4\u30eb\u306b\u3001\
-\n \"jsp.initparams=scratchdir=<dir-name>\"
\u3092\u8ffd\u52a0\u3057\u3066\u304f\u3060\u3055\u3044\u3002
-jsp.error.bad.scratch.dir=\u3042\u306a\u305f\u304c\u6307\u5b9a\u3057\u305fscratchDir: {0}
\u306f\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093
-jsp.message.scratch.dir.is=JSP\u30a8\u30f3\u30b8\u30f3\u306eScratchdir: {0}
-jsp.message.parent_class_loader_is=\u89aa\u30af\u30e9\u30b9\u30ed\u30fc\u30c0: {0}
-jsp.message.dont.modify.servlets=\u91cd\u8981:
\u751f\u6210\u3055\u308c\u305f\u30b5\u30fc\u30d6\u30ec\u30c3\u30c8\u3092\u5909\u66f4\u3057\u3066\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.not.impl.comments=\u5185\u90e8\u30a8\u30e9\u30fc:
Comments\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.directives=\u5185\u90e8\u30a8\u30e9\u30fc:
Directives\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.declarations=\u5185\u90e8\u30a8\u30e9\u30fc:
Declarations\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.expressions=\u5185\u90e8\u30a8\u30e9\u30fc:
Expressions\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.scriptlets=\u5185\u90e8\u30a8\u30e9\u30fc:
Scriptlets\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.usebean=\u5185\u90e8\u30a8\u30e9\u30fc:
useBean\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.getp=\u5185\u90e8\u30a8\u30e9\u30fc:
getProperty\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.setp=\u5185\u90e8\u30a8\u30e9\u30fc:
setProperty\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.plugin=\u5185\u90e8\u30a8\u30e9\u30fc:
plugin\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.forward=\u5185\u90e8\u30a8\u30e9\u30fc:
forward\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.not.impl.include=\u5185\u90e8\u30a8\u30e9\u30fc:
include\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.unavailable=JSP\u306f\u5229\u7528\u4e0d\u53ef\u3068\u30de\u30fc\u30af\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.usebean.missing.attribute=useBean:
id\u5c5e\u6027\u304c\u5b58\u5728\u3057\u306a\u3044\u304b\u3001\u30b9\u30da\u30eb\u30df\u30b9\u3067\u3059
-jsp.error.usebean.missing.type=useBean ({0}):
class\u5c5e\u6027\u304btype\u5c5e\u6027\u3092\u6307\u5b9a\u3057\u3066\u304f\u3060\u3055\u3044:
-jsp.error.usebean.duplicate=useBean:
beanName\u5c5e\u6027\u304c\u91cd\u8907\u3057\u3066\u3044\u307e\u3059: {0}
-jsp.error.usebean.prohibited.as.session=\u4ee5\u524d\u306b\u5b9a\u7fa9\u3057\u305fJSP\u6307\u793a\u5b50\u306b\u3088\u3063\u3066\u7981\u6b62\u3055\u308c\u3066\u3044\u308b\u305f\u3081\u306b\u3001session
bean {0} \u3068\u3057\u3066\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093:
-jsp.error.usebean.not.both=useBean:
class\u5c5e\u6027\u3068beanName\u5c5e\u6027\u306e\u4e21\u65b9\u3092\u540c\u6642\u306b\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093:
-jsp.error.usebean.bad.type.cast=useBean ({0}): type ({1}) \u306fclass ({2})
\u304b\u3089\u5272\u308a\u5f53\u3066\u3089\u308c\u307e\u305b\u3093
-jsp.error.invalid.scope='scope'\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059:
{0}
(\"page\"\u3001\"request\"\u3001\"session\"\u53c8\u306f\"application\"\u306e\u3069\u308c\u304b\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093)
-jsp.error.classname=.class\u30d5\u30a1\u30a4\u30eb\u304b\u3089\u30af\u30e9\u30b9\u540d\u3092\u6c7a\u5b9a\u3067\u304d\u307e\u305b\u3093
-jsp.warning.bad.type=\u8b66\u544a:
.class\u30d5\u30a1\u30a4\u30eb\u4e2d\u306e\u578b\u304c\u9055\u3044\u307e\u3059
-jsp.error.data.file.write=\u30c7\u30fc\u30bf\u30d5\u30a1\u30a4\u30eb\u3092\u66f8\u304d\u8fbc\u307f\u4e2d\u306e\u30a8\u30e9\u30fc\u3067\u3059
-jsp.error.page.invalid.buffer=page\u6307\u793a\u5b50:
\u7121\u52b9\u306a\u30d0\u30c3\u30d5\u30a1\u30b5\u30a4\u30ba\u3067\u3059
-jsp.error.page.conflict.contenttype=page\u6307\u793a\u5b50:
'contentType'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.contenttype=page\u6307\u793a\u5b50:
contentType\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.session=page\u6307\u793a\u5b50:
'session'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.session=page\u6307\u793a\u5b50:
session\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.buffer=page\u6307\u793a\u5b50:
'buffer'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.buffer=page\u6307\u793a\u5b50:
buffer\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.autoflush=page\u6307\u793a\u5b50:
'autoFlush'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.autoflush=page\u6307\u793a\u5b50:
autoFlush\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.isthreadsafe=page\u6307\u793a\u5b50:
'isThreadSafe'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.isthreadsafe=page\u6307\u793a\u5b50:
isThreadSafe\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.info=page\u6307\u793a\u5b50:
'info'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.info=page\u6307\u793a\u5b50:
info\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.iserrorpage=page\u6307\u793a\u5b50:
'isErrorPage'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.iserrorpage=page\u6307\u793a\u5b50:
isErrorPage\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.page.conflict.errorpage=page\u6307\u793a\u5b50:
'errorPage'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.conflict.language=page\u6307\u793a\u5b50:
'language'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.tag.conflict.language=tag\u6307\u793a\u5b50:
'language'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.language.nonjava=page\u6307\u793a\u5b50:
\u7121\u52b9\u306alanguage\u5c5e\u6027\u3067\u3059
-jsp.error.tag.language.nonjava=tag\u6307\u793a\u5b50:
\u7121\u52b9\u306alanguage\u5c5e\u6027\u3067\u3059
-jsp.error.page.defafteruse.language=page\u6307\u793a\u5b50:
scriptlet\u306e\u5f8c\u3067language\u5c5e\u6027\u3092\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093
-jsp.error.page.nomapping.language=page\u6307\u793a\u5b50
language\u5c5e\u6027\u306e\u30de\u30c3\u30d4\u30f3\u30b0\u304c\u5b58\u5728\u3057\u307e\u305b\u3093:
-jsp.error.page.conflict.extends=page\u6307\u793a\u5b50:
'extends'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.conflict.iselignored=page\u6307\u793a\u5b50:
'isELIgnored'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.tag.conflict.iselignored=tag\u6307\u793a\u5b50:
'isELIgnored'\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {0}, \u65b0: {1})
-jsp.error.page.invalid.iselignored=page\u6307\u793a\u5b50:
isELIgnored\u306b\u7121\u52b9\u306a\u5024\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.tag.invalid.iselignored=tag\u6307\u793a\u5b50:
isELIgnored\u306b\u7121\u52b9\u306a\u5024\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.page.multi.pageencoding=page\u6307\u793a\u5b50\u306f\u8907\u6570\u306epageencoding\u3092\u6301\u3064\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.tag.conflict.attr=Tag\u6307\u793a\u5b50:
\u5c5e\u6027\"{0}\"\u3092\u7570\u306a\u308b\u5024\u3067\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u4e0d\u6b63\u3067\u3059
(\u65e7: {1}, \u65b0: {2})
-jsp.error.tag.multi.pageencoding=tag\u6307\u793a\u5b50\u306f\u8907\u6570\u306epageencoding\u3092\u6301\u3064\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.page.bad_b_and_a_combo=page\u6307\u793a\u5b50:
buffer=\"none\"\u3068autoFlush=\"false\"\u3092\u540c\u6642\u306b\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093
-jsp.error.not.impl.taglib=\u5185\u90e8\u30a8\u30e9\u30fc:
\u30bf\u30b0\u62e1\u5f35\u5b50\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.include.missing.file=\u53d6\u308a\u8fbc\u3080\u30d5\u30a1\u30a4\u30eb\u5f15\u6570\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.include.bad.file=include\u5c5e\u6027\u306e\u30d5\u30a1\u30a4\u30eb\u5f15\u6570\u304c\u9593\u9055\u3063\u3066\u3044\u307e\u3059
-jsp.error.include.exception={0} \u3092\u53d6\u308a\u8fbc\u3081\u307e\u305b\u3093
-jsp.error.stream.closed=\u30b9\u30c8\u30ea\u30fc\u30e0\u304c\u30af\u30ed\u30fc\u30ba\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.invalid.forward=\u7121\u52b9\u306aforward\u30bf\u30b0\u3067\u3059
-jsp.error.unknownException=\u51e6\u7406\u4e0d\u53ef\u80fd\u306a\u30a8\u30e9\u30fc\u3067\u3059!
\u3053\u306e\u3088\u3046\u306a\u30a8\u30e9\u30fc\u3092\u3088\u308a\u8a73\u7d30\u306b\u5831\u544a\u3059\u308b\u30a8\u30e9\u30fc\u30da\u30fc\u30b8\u3092\u6301\u3063\u305f\u65b9\u304c\u3088\u3044\u304b\u3082\u3057\u308c\u307e\u305b\u3093
-jsp.error.invalid.directive=\u7121\u52b9\u306a\u6307\u793a\u5b50\u3067\u3059
-jsp.error.directive.istagfile={0}
\u6307\u793a\u5b50\u306f\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u4e2d\u3067\u306f\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093
-jsp.error.directive.isnottagfile={0}
\u6307\u793a\u5b50\u306f\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u4e2d\u3067\u3057\u304b\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093
-jsp.error.tagfile.tld.name=TLD\u4e2d\u306e\u30bf\u30b0\u6307\u793a\u5b50\u306e\"tag-file\"\u8981\u7d20\u306e\"name\"\u30bf\u30b0\u306f
{1} \u3067\u3059\u304c\uff0c\"name\"\u5c5e\u6027\u306f\u5024 {0}
\u3092\u6301\u3063\u3066\u3044\u307e\u3059
-jsp.error.action.istagfile={0}
\u30a2\u30af\u30b7\u30e7\u30f3\u306f\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u4e2d\u3067\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093
-jsp.error.action.isnottagfile={0}
\u30a2\u30af\u30b7\u30e7\u30f3\u306f\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u4e2d\u3067\u306e\u307f\u4f7f\u7528\u3067\u304d\u307e\u305b\u3093
-jsp.error.unterminated={0}
\u30bf\u30b0\u304c\u7d42\u4e86\u3057\u3066\u3044\u307e\u305b\u3093
-jsp.error.usebean.notinsamefile=useBean\u30bf\u30b0\u306f\u3001\u540c\u4e00\u30d5\u30a1\u30a4\u30eb\u4e2d\u3067\u958b\u59cb\u3057\u3001\u7d42\u4e86\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.loadclass.taghandler=\u30bf\u30b0 \"{1}\"
\u306b\u30bf\u30b0\u30cf\u30f3\u30c9\u30e9\u30af\u30e9\u30b9 \"{0}\"
\u3092\u30ed\u30fc\u30c9\u3067\u304d\u307e\u305b\u3093
-jsp.error.unable.compile=JSP\u306e\u30af\u30e9\u30b9\u3092\u30b3\u30f3\u30d1\u30a4\u30eb\u3067\u304d\u307e\u305b\u3093
-jsp.error.unable.load=JSP\u306e\u30af\u30e9\u30b9\u3092\u30ed\u30fc\u30c9\u3067\u304d\u307e\u305b\u3093
-jsp.error.unable.rename=\u30af\u30e9\u30b9\u30d5\u30a1\u30a4\u30eb {0} \u3092 {1}
\u306b\u30d5\u30a1\u30a4\u30eb\u540d\u3092\u5909\u66f4\u3067\u304d\u307e\u305b\u3093
-jsp.error.mandatory.attribute={0}: \u5fc5\u9808\u5c5e\u6027 {1}
\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.engine.info=Jasper JSP 2.0\u30a8\u30f3\u30b8\u30f3
-jsp.error.invalid.expression="{0}"
\u306f\u7121\u52b9\u306a\u5f0f\u3092\u542b\u3093\u3067\u3044\u307e\u3059: {1}
-jsp.error.invalid.attribute={0}\u306f\u7121\u52b9\u306a\u5c5e\u6027\u3092\u6301\u3063\u3066\u3044\u307e\u3059:
{1}
-jsp.error.usebean.class.notfound=\u30af\u30e9\u30b9: {0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.file.cannot.read=\u30d5\u30a1\u30a4\u30eb\u304c\u8aad\u3081\u307e\u305b\u3093:
{0}
-jsp.error.file.already.registered=\u30d5\u30a1\u30a4\u30eb {0}
\u306e\u518d\u5e30\u7684\u306a\u53d6\u308a\u8fbc\u307f\u3067\u3059
-jsp.error.file.not.registered=include\u5c5e\u6027\u4e2d\u306e\u30d5\u30a1\u30a4\u30eb {0}
\u304c\u5b58\u5728\u3057\u307e\u305b\u3093
-jsp.error.quotes.unterminated=\u5f15\u7528\u7b26\u304c\u7d42\u4e86\u3057\u3066\u3044\u307e\u305b\u3093
-jsp.error.attr.quoted=\u5c5e\u6027\u5024\u306f\u5f15\u7528\u7b26\u3067\u56f2\u308f\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.attr.novalue=\u5c5e\u6027 {0}
\u306b\u306f\u5024\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.tag.attr.unterminated=\u30bf\u30b0\u306e\u5c5e\u6027\u30ea\u30b9\u30c8\u304c\u7d42\u4e86\u3057\u3066\u3044\u307e\u305b\u3093
-jsp.error.param.noname=PARAM\u30bf\u30b0\u306bname\u5c5e\u6027\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.param.novalue=PARAM\u30bf\u30b0\u306bvalue\u5c5e\u6027\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.beans.nullbean=null\u30aa\u30d6\u30b8\u30a7\u30af\u30c8\u306bBean\u64cd\u4f5c\u3092\u304a\u3053\u306a\u304a\u3046\u3068\u3057\u307e\u3057\u305f
-jsp.error.beans.nobeaninfo=\u30bf\u30a4\u30d7 ''{0}''
\u306eBean\u306bBeanInfo\u304c\u306a\u3044\u306e\u3092\u691c\u51fa\u3057\u307e\u3057\u305f,
\u30af\u30e9\u30b9\u304c\u5b58\u5728\u3057\u306a\u3044\u304b\u3082\u3057\u308c\u307e\u305b\u3093
-jsp.error.beans.introspection=\u30bf\u30a4\u30d7 ''{1}''
\u306eBean\u4e2d\u306e\u5c5e\u6027 ''{0}''
\u306eread\u30e1\u30bd\u30c3\u30c9\u3092\u5185\u7701\u4e2d\u306b\u4f8b\u5916\u304c\u767a\u751f\u3057\u307e\u3057\u305f:\n{2}
-jsp.error.beans.nomethod=\u30bf\u30a4\u30d7 ''{1}''
\u306eBean\u4e2d\u306e\u5c5e\u6027 ''{0}''
\u3092\u8aad\u307f\u8fbc\u3080\u30e1\u30bd\u30c3\u30c9\u3092\u767a\u898b\u3067\u304d\u307e\u305b\u3093\u3067\u3057\u305f
-jsp.error.beans.nomethod.setproperty=\u30bf\u30a4\u30d7''{2}''\u306eBean\u306e\u30bf\u30a4\u30d7
''{1}'' \u306e\u5c5e\u6027 ''{0}''
\u3092\u66f8\u304d\u8fbc\u3080\u30e1\u30bd\u30c3\u30c9\u3092\u767a\u898b\u3067\u304d\u307e\u305b\u3093\u3067\u3057\u305f
-jsp.error.beans.noproperty=\u30bf\u30a4\u30d7 ''{1}''
\u306ebean\u4e2d\u306e\u5c5e\u6027 ''{0}''
\u306e\u60c5\u5831\u3092\u767a\u898b\u3067\u304d\u307e\u305b\u3093\u3067\u3057\u305f
-jsp.error.beans.setproperty.noindexset=\u30a4\u30f3\u30c7\u30c3\u30af\u30b9\u4ed8\u304d\u306e\u5c5e\u6027\u3092\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093
-jsp.error.include.tag=\u7121\u52b9\u306ajsp:include\u30bf\u30b0\u3067\u3059
-jsp.error.include.noflush=jsp:include\u30bf\u30b0\u306b \"flush=true\"
\u3092\u5b9a\u7fa9\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.include.badflush=jsp:include page=\"...\" flush=\"true\"
\u306f\u3001JSP
1.0\u3067\u306e\u307f\u6709\u52b9\u306a\u7d44\u307f\u5408\u308f\u305b\u3067\u3059
-jsp.error.attempt_to_clear_flushed_buffer=\u30a8\u30e9\u30fc:
\u65e2\u306b\u30d5\u30e9\u30c3\u30b7\u30e5\u3055\u308c\u3066\u3044\u308b\u30d0\u30c3\u30d5\u30a1\u3092\u30af\u30ea\u30a2\u3057\u3088\u3046\u3068\u3057\u307e\u3057\u305f
-jsp.error.overflow=\u30a8\u30e9\u30fc:
JSP\u30d0\u30c3\u30d5\u30a1\u304c\u30aa\u30fc\u30d0\u30fc\u30d5\u30ed\u30fc\u3057\u307e\u3057\u305f
-jsp.error.paramexpected=\"name\"\u5c5e\u6027 \u3068 \"value\"
\u5c5e\u6027\u3092\u6301\u3064 \"jsp:param\"
\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.param.invalidUse=jsp:include\u3001jsp:forward\u3001\u53c8\u306fjsp:params\u8981\u7d20\u306e\u5916\u3067jsp:param\u30a2\u30af\u30b7\u30e7\u30f3\u3092\u4f7f\u7528\u3057\u3066\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.params.invalidUse=jsp:params\u306fjsp:plugin\u306e\u76f4\u63a5\u306e\u5b50\u4f9b\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.fallback.invalidUse=jsp:fallback\u306fjsp:plugin\u306e\u76f4\u63a5\u306e\u5b50\u4f9b\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.namedAttribute.invalidUse=jsp:attribute\u306f\u6a19\u6e96\u53c8\u306f\u30ab\u30b9\u30bf\u30e0\u30a2\u30af\u30b7\u30e7\u30f3\u306e\u526f\u8981\u7d20\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspbody.invalidUse=jsp:body\u306f\u6a19\u6e96\u53c8\u306f\u30ab\u30b9\u30bf\u30e0\u30a2\u30af\u30b7\u30e7\u30f3\u306e\u526f\u8981\u7d20\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.closeindividualparam=param\u30bf\u30b0\u306f \"/>\"
\u3067\u9589\u3058\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.closeparams=param\u30bf\u30b0\u306f/params\u3067\u9589\u3058\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.params.emptyBody=jsp:params\u306f\u5c11\u306a\u304f\u3068\u3082\u4e00\u3064\u306e\u30cd\u30b9\u30c8\u3057\u305fjsp:param\u3092\u542b\u307e\u306d\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.params.illegalChild=jsp:params\u306fjsp:param\u4ee5\u5916\u306e\u30cd\u30b9\u30c8\u3057\u305f\u8981\u7d20\u3092\u542b\u3093\u3067\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.plugin.notype=jsp:plugin\u3067type\u5c5e\u6027\u304c\u5ba3\u8a00\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.plugin.badtype=jsp:plugin\u306e
'type'\u5c5e\u6027\u306e\u5024\u304c\u7121\u52b9\u3067\u3059:
'bean'\u53c8\u306f'applet'\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.plugin.nocode=jsp:plugin\u3067code\u5c5e\u6027\u304c\u5ba3\u8a00\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.ise_on_clear=\u30d0\u30c3\u30d5\u30a1\u30b5\u30a4\u30ba\u304c0\u306e\u6642\u306bclear()\u3092\u5b9f\u884c\u3057\u3066\u3082\u7121\u52b9\u3067\u3059
-jsp.error.setproperty.beanNotFound=setProperty: Bean {0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.getproperty.beanNotFound=getProperty: Bean {0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.setproperty.ClassNotFound=setProperty: \u30af\u30e9\u30b9 {0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-# typo ?
-#jsp.error.setproperty.invalidSayntax=setProperty:
property=*\u306e\u5834\u5408\u306fnull\u3067\u306a\u3044\u5024\u3092\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093
-jsp.error.setproperty.invalidSyntax=setProperty:
property=*\u306e\u5834\u5408\u306fnull\u3067\u306a\u3044\u5024\u3092\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093
-jsp.error.setproperty.beanInfoNotFound=setproperty: Bean {0}
\u306ebeanInfo\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.setproperty.paramOrValue=setProperty:
param\u5c5e\u6027\u304bvalue\u5c5e\u6027\u306e\u3069\u3061\u3089\u304b\u4e00\u3064\u3060\u3051\u3092\u6307\u5b9a\u3067\u304d\u307e\u3059
-jsp.error.setproperty.arrayVal=setProperty: \u5c5e\u6027\u914d\u5217 {0}
\u3092\u6587\u5b57\u5217\u5b9a\u6570\u5024\u3067\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093
-jsp.warning.keepgen=\u8b66\u544a: initParam
keepgenerated\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002
\u30c7\u30d5\u30a9\u30eb\u30c8\u5024 \"false\"
\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.xpoweredBy=\u8b66\u544a: Invalid value for the initParam
xpoweredBy\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\u30c7\u30d5\u30a9\u30eb\u30c8\u5024
\"false\" \u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.enablePooling=\u8b66\u544a: initParam
enablePooling\u304c\u7121\u52b9\u306a\u5024\u3067\u3059\u3002\"true\"\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.invalidTagPoolSize=\u8b66\u544a:
tagPoolSize\u306e\u521d\u671f\u30d1\u30e9\u30e1\u30fc\u30bf\u304c\u7121\u52b9\u306a\u5024\u3067\u3059\u3002{0}\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u30b5\u30a4\u30ba\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.mappedFile=\u8b66\u544a: initParam
mappedFile\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\u30c7\u30d5\u30a9\u30eb\u30c8\u5024
\"false\" \u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.sendErrToClient=\u8b66\u544a: initParam
sendErrToClient\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\u30c7\u30d5\u30a9\u30eb\u30c8\u5024
\"false\" \u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.classDebugInfo=\u8b66\u544a: initParam
classDebugInfo\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\u30c7\u30d5\u30a9\u30eb\u30c8\u5024
\"false\"\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.checkInterval=\u8b66\u544a: initParam
checkInterval\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\"300\"\u79d2\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.development=\u8b66\u544a: initParam
development\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\"true\"\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.fork=\u8b66\u544a: initParam
fork\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\"true\"\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.reloading=\u8b66\u544a: initParam
reloading\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\"true\"\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.dumpSmap=\u8b66\u544a: initParam
dumpSmap\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\"false\"\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.genchararray=\u8b66\u544a: initParam
genStrAsCharArray\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\"false\"\u306e\u30c7\u30d5\u30a9\u30eb\u30c8\u5024\u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.warning.suppressSmap=\u8b66\u544a: initParam
suppressSmap\u306e\u5024\u304c\u7121\u52b9\u3067\u3059\u3002\u30c7\u30d5\u30a9\u30eb\u30c8\u5024
\"false\" \u3092\u4f7f\u7528\u3057\u307e\u3059
-jsp.error.badtaglib=\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea {0}
\u3092\u30aa\u30fc\u30d7\u30f3\u3067\u304d\u307e\u305b\u3093: {1}
-jsp.error.badGetReader=\u30b9\u30c8\u30ea\u30fc\u30e0\u304c\u30d0\u30c3\u30d5\u30a1\u30ea\u30f3\u30b0\u3055\u308c\u3066\u3044\u306a\u3044\u5834\u5408\u306b\u306f\u3001Reader\u3092\u4f5c\u6210\u3067\u304d\u307e\u305b\u3093
-jsp.warning.unknown.element.in.taglib=taglib\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.tag=tag\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20 ({0})
\u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.tagfile=tag-file\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.attribute=attribute\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.variable=variable\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.validator=validator\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.initParam=validator\u306einit-param\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.warning.unknown.element.in.function=function\u4e2d\u306b\u672a\u77e5\u306e\u8981\u7d20
({0}) \u304c\u3042\u308a\u307e\u3059
-jsp.error.more.than.one.taglib=TLD\u306e\u4e2d\u306b\u8907\u6570\u306etaglib\u304c\u5b58\u5728\u3057\u307e\u3059:
{0}
-jsp.error.teiclass.instantiation=TagExtraInfo
class\u306e\u30ed\u30fc\u30c9\u53c8\u306f\u30a4\u30f3\u30b9\u30bf\u30f3\u30b9\u5316\u306b\u5931\u6557\u3057\u307e\u3057\u305f:
{0}
-jsp.error.non_null_tei_and_var_subelems=\u30bf\u30b0 {0}
\u306f\u4e00\u3064\u4ee5\u4e0a\u306evariable\u526f\u8981\u7d20\u3068\u4e00\u3064\u4ee5\u4e0a\u306eVariableInfo\u3092\u8fd4\u3059TagExtraInfo\u30af\u30e9\u30b9\u3092\u6301\u3063\u3066\u3044\u307e\u3059
-jsp.error.parse.error.in.TLD=\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea\u8a18\u8ff0\u5b50
{0} \u4e2d\u306e\u89e3\u6790\u30a8\u30e9\u30fc\u3067\u3059
-jsp.error.unable.to.open.TLD=\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea\u8a18\u8ff0\u5b50
{0} \u3092\u30aa\u30fc\u30d7\u30f3\u3067\u304d\u307e\u305b\u3093
-jsp.buffer.size.zero=\u30d0\u30c3\u30d5\u30a1\u30b5\u30a4\u30ba\u304c0\u4ee5\u4e0b\u3067\u3059
-jsp.error.file.not.found=JSP \u30d5\u30a1\u30a4\u30eb \"{0}\"
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.message.copyinguri={0} \u3092 {1} \u306b\u30b3\u30d4\u30fc\u3057\u307e\u3059
-jsp.message.htmlcomment=\n\u524a\u9664\u3059\u308b\u30b3\u30e1\u30f3\u30c8: \t{0}
-jsp.message.handling_directive=\n\u51e6\u7406\u3059\u308b\u6307\u793a\u5b50: {0}\t{1}
-jsp.message.handling_plugin=\nPlugin: {0}
-jsp.message.package_name_is=\u30d1\u30c3\u30b1\u30fc\u30b8\u540d: {0}
-jsp.message.class_name_is=\u30af\u30e9\u30b9\u540d: {0}
-jsp.message.java_file_name_is=Java\u30d5\u30a1\u30a4\u30eb\u540d: {0}
-jsp.message.class_file_name_is=\u30af\u30e9\u30b9\u30d5\u30a1\u30a4\u30eb\u540d: {0}
-jsp.message.accepted={1} \u3067 {0} \u3092\u53d7\u3051\u5165\u308c\u307e\u3059
-jsp.message.adding_jar=jar {0}
\u3092\u30af\u30e9\u30b9\u30d1\u30b9\u306b\u8ffd\u52a0\u3057\u307e\u3059
-jsp.message.compiling_with={0} \u3092\u30b3\u30f3\u30d1\u30a4\u30eb\u4e2d\u3067\u3059
-jsp.message.template_text=\u30c6\u30f3\u30d7\u30ec\u30fc\u30c8\u30c6\u30ad\u30b9\u30c8
-jsp.error.missing_attribute=TLD\u53c8\u306f\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u306b\u3088\u308b\u3068\u3001\u5c5e\u6027
{0} \u306f\u30bf\u30b0 {1} \u306b\u306f\u5fc5\u9808\u3067\u3059
-jsp.error.bad_attribute=TLD\u306b\u3088\u308b\u3068\u3001\u30bf\u30b0 {1}
\u306e\u5c5e\u6027 {0} \u306f\u7121\u52b9\u3067\u3059
-jsp.error.tld.unable_to_read=JAR\u30d5\u30a1\u30a4\u30eb \"{0}\"
\u304b\u3089TLD \"{1}\" \u3092\u8aad\u307f\u8fbc\u3081\u307e\u305b\u3093: {2}
-jsp.error.tld.unable_to_get_jar=TLD\u3092\u542b\u3080JAR\u30ea\u30bd\u30fc\u30b9
\"{0}\" \u3092\u53d6\u5f97\u3067\u304d\u307e\u305b\u3093 : {1}
-jsp.error.tld.missing_jar=TLD\u3092\u542b\u3080JAR\u30ea\u30bd\u30fc\u30b9
\"{0}\" \u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.webxml_not_found=web.xml\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.cmd_line.usage=\u4f7f\u7528\u6cd5: [-dd
<\u51fa\u529b\u30c7\u30a3\u30ec\u30af\u30c8\u30ea\u306e\u30d1\u30b9>]
[-keepgenerated] \
-<.jsp\u30d5\u30a1\u30a4\u30eb\u7fa4>
-jsp.message.cp_is=\u30af\u30e9\u30b9\u30d1\u30b9 {0} \u306f {1} \u3067\u3059
-jsp.error.unable.to_load_taghandler_class=\u30bf\u30b0\u30cf\u30f3\u30c9\u30e9\u30af\u30e9\u30b9
{0} \u3092 {1} \u306e\u305f\u3081\u306b\u30ed\u30fc\u30c9\u3067\u304d\u307e\u305b\u3093
-jsp.error.unable.to_find_method=\u5c5e\u6027 {0}
\u306esetter\u30e1\u30bd\u30c3\u30c9\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.unable.to_convert_string=\u5c5e\u6027 {1}\u306e\u6587\u5b57\u5217\u3092
{0}\u306b\u5909\u63db\u3067\u304d\u307e\u305b\u3093
-jsp.error.unable.to_introspect=\u30bf\u30b0\u30cf\u30f3\u30c9\u30e9\u30af\u30e9\u30b9 {0}
\u3092 {1} \u306e\u305f\u3081\u306b\u5185\u7701\u3067\u304d\u307e\u305b\u3093
-jsp.error.bad_tag=\u30d7\u30ec\u30d5\u30a3\u30c3\u30af\u30b9
{1}\u3067\u30a4\u30f3\u30dd\u30fc\u30c8\u3055\u308c\u305f\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea\u306b\u306f\u3001\u30bf\u30b0
{0} \u306f\u5b58\u5728\u3057\u307e\u305b\u3093
-jsp.error.xml.bad_tag=URI \"{1}\"
\u306b\u95a2\u9023\u3065\u3051\u3089\u308c\u305f\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea\u306e\u4e2d\u306b\u306f\u30bf\u30b0
\"{0}\" \u306f\u5b9a\u7fa9\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.bad_string_Character=\u9577\u30550\u306e\u914d\u5217\u304b\u3089\u306f\u6587\u5b57\u3092\u53d6\u5f97\u3067\u304d\u307e\u305b\u3093
-jsp.error.bad_string_char=\u9577\u30550\u306e\u914d\u5217\u304b\u3089\u306f\u6587\u5b57\u3092\u53d6\u5f97\u3067\u304d\u307e\u305b\u3093
-jsp.warning.compiler.class.cantcreate=\u6307\u5b9a\u3055\u308c\u305f\u30b3\u30f3\u30d1\u30a4\u30e9\u30d7\u30e9\u30b0\u30a4\u30f3\u30af\u30e9\u30b9
{0} \u306e\u30a4\u30f3\u30b9\u30bf\u30f3\u30b9\u3092 {1}
\u306e\u305f\u3081\u306b\u4f5c\u6210\u3067\u304d\u307e\u305b\u3093\u3002\u30c7\u30d5\u30a9\u30eb\u30c8\u3092Sun\u306eJava\u30b3\u30f3\u30d1\u30a4\u30e9\u306b\u3057\u307e\u3059\u3002
-jsp.warning.compiler.class.notfound=\u6307\u5b9a\u3055\u308c\u305f\u30b3\u30f3\u30d1\u30a4\u30e9\u30d7\u30e9\u30b0\u30a4\u30f3\u30af\u30e9\u30b9
{0} \u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093\u3002not found.
\u30c7\u30d5\u30a9\u30eb\u30c8\u3092Sun\u306eJava\u30b3\u30f3\u30d1\u30a4\u30e9\u306b\u3057\u307e\u3059\u3002
-jsp.warning.compiler.path.notfound=\u6307\u5b9a\u3055\u308c\u305f\u30b3\u30f3\u30d1\u30a4\u30e9\u30d1\u30b9
{0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093\u3002\u30b7\u30b9\u30c6\u30e0\u306ePATH\u3092\u30c7\u30d5\u30a9\u30eb\u30c8\u306b\u3057\u307e\u3059\u3002
-jsp.error.jspc.uriroot_not_dir=-uriroot
\u30aa\u30d7\u30b7\u30e7\u30f3\u306f\u3001\u65e2\u306b\u5b58\u5728\u3059\u308b\u30c7\u30a3\u30ec\u30af\u30c8\u30ea\u3092\u6307\u5b9a\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspc.missingTarget=\u30bf\u30fc\u30b2\u30c3\u30c8\u304c\u3042\u308a\u307e\u305b\u3093:
-webapp\u53c8\u306f-uriroot\uff0c\u53c8\u306f\u4e00\u3064\u4ee5\u4e0a\u306eJSP\u30da\u30fc\u30b8\u3092\u6307\u5b9a\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspc.no_uriroot=uriroot\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u306a\u3044\u306e\u3067\u3001\u6307\u5b9a\u3055\u308c\u305fJSP\u30d5\u30a1\u30a4\u30eb(\u7fa4)\u3092\u914d\u7f6e\u3067\u304d\u307e\u305b\u3093
-jspc.implicit.uriRoot=uriRoot\u306f\u30c7\u30d5\u30a9\u30eb\u30c8"{0}"\u306b\u8a2d\u5b9a\u3055\u308c\u307e\u3059
-jspc.usage=\u4f7f\u7528\u6cd5: jspc <options> [--] <jsp files>\n\
-JSP\u30d5\u30a1\u30a4\u30eb\u306e\u5834\u6240\u306f\u6b21\u306e\u30aa\u30d7\u30b7\u30e7\u30f3\u3067\u6307\u5b9a\u3059\u308b\u304b\u3001\n\
-\ -webapp <dir>
web-app\u3092\u542b\u3080\u30c7\u30a3\u30ec\u30af\u30c8\u30ea\u3002\u3059\u3079\u3066\u306eJSP\u30d5\u30a1\u30a4\u30eb\u306f\n\
-\ \u518d\u5e30\u7684\u306b\u89e3\u6790\u3055\u308c\u308b\n\
-\u53c8\u306f\u6b21\u306e\u4efb\u610f\u306e\u6570\u306e\u30d5\u30a1\u30a4\u30eb\u3067\u6307\u5b9a\u3057\u307e\u3059\u3002\n\
-\ <file>
JSP\u3068\u3057\u3066\u89e3\u6790\u3055\u308c\u308b\u30d5\u30a1\u30a4\u30eb\n\
-\u30aa\u30d7\u30b7\u30e7\u30f3\u306f\u4ee5\u4e0b\u306e\u901a\u308a\u3067\u3059\n\
-\ -help
\u3053\u306e\u30d8\u30eb\u30d7\u30e1\u30c3\u30bb\u30fc\u30b8\u306e\u8868\u793a\n\
-\ -v Verbose\u30e2\u30fc\u30c9\n\
-\ -d <dir> \u51fa\u529b\u30c7\u30a3\u30ec\u30af\u30c8\u30ea\n\
-\ -l
\u5931\u6557\u3057\u305fJSP\u30da\u30fc\u30b8\u306e\u540d\u524d\u306e\u51fa\u529b\n\
-\ -s
\u6210\u529f\u3057\u305fJSP\u30da\u30fc\u30b8\u306e\u540d\u524d\u306e\u51fa\u529b\n\
-\ -p <name>
\u30bf\u30fc\u30b2\u30c3\u30c8\u30d1\u30c3\u30b1\u30fc\u30b8\u306e\u540d\u524d
(\u30c7\u30d5\u30a9\u30eb\u30c8\u306forg.apache.jsp)\n\
-\ -c <name>
\u30bf\u30fc\u30b2\u30c3\u30c8\u30af\u30e9\u30b9\u306e\u540d\u524d
(\u6700\u521d\u306eJSP\u30da\u30fc\u30b8\u3060\u3051\u306b\u9069\u7528\u3055\u308c\u308b)\n\
-\ -mapped
JSP\u306e\u5404HTML\u884c\u3054\u3068\u306bwrite()\u30b3\u30fc\u30eb\u3092\u751f\u6210\n\
-\ -die[#]
\u81f4\u547d\u7684\u30a8\u30e9\u30fc\u306b\u30a8\u30e9\u30fc\u30ea\u30bf\u30fc\u30f3\u30b3\u30fc\u30c9(#)\u3092\u751f\u6210
(\u30c7\u30d5\u30a9\u30eb\u30c8\u306f1)\n\
-\ -uribase <dir>
\u30b3\u30f3\u30d1\u30a4\u30eb\u304c\u76f8\u5bfe\u7684\u306b\u304a\u3053\u306a\u308f\u308c\u308buri\u30c7\u30a3\u30ec\u30af\u30c8\u30ea\n\
-\ (\u30c7\u30d5\u30a9\u30eb\u30c8\u306f"/")\n\
-\ -uriroot <dir> -webapp\u3068\u540c\u3058\n\
-\ -compile
\u751f\u6210\u3057\u305f\u30b5\u30fc\u30d6\u30ec\u30c3\u30c8\u306e\u30b3\u30f3\u30d1\u30a4\u30eb\n\
-\ -webinc <file>
\u30d5\u30a1\u30a4\u30eb\u306b\u90e8\u5206\u7684\u306a\u30b5\u30fc\u30d6\u30ec\u30c3\u30c8\u30de\u30c3\u30d4\u30f3\u30b0\u3092\u4f5c\u6210\n\
-\ -webxml <file>
\u30d5\u30a1\u30a4\u30eb\u306b\u5b8c\u5168\u306aweb.xml\u3092\u4f5c\u6210\n\
-\ -ieplugin <clsid> Internet Explorer\u306eJava Plugin\u306eclassid\n\
-\ -classpath <path>
java.class.path\u30b7\u30b9\u30c6\u30e0\u30d7\u30ed\u30d1\u30c6\u30a3\u306e\u4e0a\u66f8\u304d\n\
-\ -xpoweredBy
X-Powered-By\u30ec\u30b9\u30dd\u30f3\u30b9\u30d8\u30c3\u30c0\u306e\u8ffd\u52a0\n\
-\ -trimSpaces
\u30a2\u30af\u30b7\u30e7\u30f3\u3084\u6307\u793a\u5b50\u306e\u9593\u306e\u30c6\u30f3\u30d7\u30ec\u30fc\u30c8\u30c6\u30ad\u30b9\u30c8\u4e2d\u306e\u30b9\u30da\u30fc\u30b9\u3092\u524a\u9664\n\
-\ -trimSpaces Trim spaces in template text between actions, directives\n\
-\ -javaEncoding <enc> Set the encoding charset for Java classes (default
UTF-8)\n\
-\ -source <version> Set the -source argument to the compiler (default 1.4)\n\
-\ -target <version> Set the -target argument to the compiler (default 1.4)\n\
-
-jspc.webxml.header=<?xml version="1.0"
encoding="ISO-8859-1"?>\n\
-\n\
-<!DOCTYPE web-app\n\
-\ PUBLIC "-//Sun Microsystems, Inc.//DTD Web Application 2.3//EN"\n\
-\ "http://java.sun.com/dtd/web-app_2_3.dtd">\n\
-<!--\n\
-Automatically created by Apache Jakarta Tomcat JspC.\n\
--->\n\
-<web-app>\n\
-\n
-jspc.webxml.footer=\n\
-</web-app>\n\
-\n
-jspc.webinc.header=\n\
-<!--\n\
-Automatically created by Apache Jakarta Tomcat JspC.\n\
-Place this fragment in the web.xml before all icon, display-name,\n\
-description, distributable, and context-param elements.\n\
--->\n
-jspc.webinc.footer=\n\
-<!--\n\
-All session-config, mime-mapping, welcome-file-list, error-page, taglib,\n\
-resource-ref, security-constraint, login-config, security-role,\n\
-env-entry, and ejb-ref elements should follow this fragment.\n\
--->\n
-jspc.webinc.insertEnd=<!-- JSPC servlet mappings end -->
-jspc.webinc.insertStart=<!-- JSPC servlet mappings start -->
-jspc.error.jasperException=\u30a8\u30e9\u30fc: \u30d5\u30a1\u30a4\u30eb
''{0}''
\u306f\u6b21\u306e\u4f8b\u5916\u3092\u767a\u751f\u3057\u307e\u3057\u305f: {1}
-jspc.error.generalException=\u30a8\u30e9\u30fc: \u30d5\u30a1\u30a4\u30eb
''{0}''
\u306f\u6b21\u306e\u4f8b\u5916\u3092\u767a\u751f\u3057\u307e\u3057\u305f:
-jspc.error.fileDoesNotExist=\u30d5\u30a1\u30a4\u30eb\u5f15\u6570 ''{0}''
\u306f\u5b58\u5728\u3057\u307e\u305b\u3093\u3002
-jspc.error.emptyWebApp=-webapp\u30aa\u30d7\u30b7\u30e7\u30f3\u306b\u306f\u3001\u30d5\u30a1\u30a4\u30eb\u5f15\u6570\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.library.invalid=\u30e9\u30a4\u30d6\u30e9\u30ea{0}\u306b\u5f93\u3046\u3068JSP\u30da\u30fc\u30b8\u306f\u7121\u52b9\u3067\u3059:
{1}
-jsp.error.tlvclass.instantiation=TagLibraryValidator\u30af\u30e9\u30b9\u306e\u30ed\u30fc\u30c9\u53c8\u306f\u30a4\u30f3\u30b9\u30bf\u30f3\u30b9\u5316\u306b\u5931\u6557\u3057\u307e\u3057\u305f:
{0}
-jsp.error.tlv.invalid.page={0}
\u306b\u5bfe\u3059\u308bTagLibraryValidator\u306e\u691c\u8a3c\u30a8\u30e9\u30fc\u30e1\u30c3\u30bb\u30fc\u30b8\u3067\u3059
({1})
-jsp.error.tei.invalid.attributes={0}
\u306b\u5bfe\u3059\u308bTagExtraInfo\u304b\u3089\u306e\u691c\u8a3c\u30a8\u30e9\u30fc\u30e1\u30c3\u30bb\u30fc\u30b8\u3067\u3059
-jsp.parser.sax.propertynotsupported=SAX\u30d7\u30ed\u30d1\u30c6\u30a3\u304c\u30b5\u30dd\u30fc\u30c8\u3055\u308c\u307e\u305b\u3093:
{0}
-jsp.parser.sax.propertynotrecognized=SAX\u30d7\u30ed\u30d1\u30c6\u30a3\u304c\u8a8d\u8b58\u3055\u308c\u307e\u305b\u3093:
{0}
-jsp.parser.sax.featurenotsupported=SAX\u30d5\u30a3\u30fc\u30c1\u30e3\u304c\u30b5\u30dd\u30fc\u30c8\u3055\u308c\u307e\u305b\u3093:
{0}
-jsp.parser.sax.featurenotrecognized=SAX\u30d5\u30a3\u30fc\u30c1\u30e3\u304c\u8a8d\u8b58\u3055\u308c\u307e\u305b\u3093:
{0}
-jsp.error.no.more.content=\u5fc5\u8981\u306a\u89e3\u6790\u4e2d\u306b\u5185\u5bb9\u306e\u6700\u5f8c\u307e\u3067\u9054\u3057\u307e\u3057\u305f:
\u30bf\u30b0\u306e\u30cd\u30b9\u30c8\u306e\u30a8\u30e9\u30fc\u304b\u3082\u3057\u308c\u307e\u305b\u3093
-jsp.error.parse.xml=\u30d5\u30a1\u30a4\u30eb{0}\u306eXML\u89e3\u6790\u30a8\u30e9\u30fc
-jsp.error.parse.xml.line=\u30d5\u30a1\u30a4\u30eb{0}\u306eXML\u89e3\u6790\u30a8\u30e9\u30fc:
(\u884c {1}, \u5217 {2})
-jsp.error.parse.xml.scripting.invalid.body={0}
\u8981\u7d20\u306e\u30dc\u30c7\u30a3\u306fXML\u8981\u7d20\u3092\u542b\u3093\u3067\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.internal.tldinit=TldLocationsCache\u3092\u521d\u671f\u5316\u4e2d\u306e\u4f8b\u5916\u3067\u3059:
{0}
-jsp.error.internal.filenotfound=\u5185\u90e8\u30a8\u30e9\u30fc: \u30d5\u30a1\u30a4\u30eb
{0} \u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.internal.evaluator_not_found=\u5185\u90e8\u30a8\u30e9\u30fc:
\u5f0f\u691c\u8a3c\u5668\u3092\u30ed\u30fc\u30c9\u3067\u304d\u307e\u305b\u3093
-jsp.error.parse.xml.invalidPublicId=\u7121\u52b9\u306aPUBLIC ID: {0}
-jsp.error.include.flush.invalid.value=flush\u5c5e\u6027\u306b\u7121\u52b9\u306a\u5024\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u3059:
{0}
-jsp.error.unsupported.encoding=\u30b5\u30dd\u30fc\u30c8\u3055\u308c\u3066\u3044\u306a\u3044\u30a8\u30f3\u30b3\u30fc\u30c7\u30a3\u30f3\u30b0\u3067\u3059:
{0}
-tld.error.variableNotAllowed=null\u3067\u306a\u3044\u30aa\u30d6\u30b8\u30a7\u30af\u30c8\u3092\u8fd4\u3059TagExtraInfo\u3092\u6301\u3064\u4e00\u3064\u4ee5\u4e0a\u306e\u5909\u6570\u526f\u8981\u7d20\u3092\u6301\u3064\u30bf\u30b0\u306f\u30a8\u30e9\u30fc\u3067\u3059\u3002
-jsp.error.tldInWebDotXmlNotFound=web.xml\u3067\u6307\u5b9a\u3055\u308c\u305fURI {0}
\u306bTLD\u3092\u914d\u7f6e\u3067\u304d\u307e\u305b\u3093
-jsp.error.taglibDirective.absUriCannotBeResolved=\u7d76\u5bfeURI: {0}
\u306fweb.xml\u3068\u3053\u306e\u30a2\u30d7\u30ea\u30b1\u30fc\u30b7\u30e7\u30f3\u3092\u914d\u5099\u3057\u305fJAR\u30d5\u30a1\u30a4\u30eb\u306e\u3069\u3061\u3089\u304b\u3067\u3082\u89e3\u6c7a\u3067\u304d\u307e\u305b\u3093
-jsp.error.taglibDirective.missing.location=taglib\u6307\u793a\u5b50\u306e\u4e2d\u306b'uri'\u5c5e\u6027\u3068'tagdir'\u5c5e\u6027\u306e\u3069\u3061\u3089\u3082\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.taglibDirective.both_uri_and_tagdir=\'uri\'\u5c5e\u6027 \u3068
\'tagdir\'\u5c5e\u6027\u306e\u4e21\u65b9\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.invalid.tagdir=\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u30c7\u30a3\u30ec\u30af\u30c8\u30ea
{0} \u304c\"/WEB-INF/tags\"\u3067\u59cb\u307e\u308a\u307e\u305b\u3093
-jsp.error.unterminated.user.tag=\u672a\u7d42\u4e86\u306e\u30e6\u30fc\u30b6\u5b9a\u7fa9\u30bf\u30b0:
\u7d42\u4e86\u30bf\u30b0 {0}
\u304c\u898b\u3064\u304b\u3089\u306a\u3044\u304b\u3001\u30cd\u30b9\u30c8\u304c\u9593\u9055\u3063\u3066\u3044\u307e\u3059
-#jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}>
cannot have template data. Template data must be encapsulated within a
<jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error:
{1}
-jspx.error.templateDataNotInJspCdata=\u8a3c\u660e\u30a8\u30e9\u30fc:
\u8981\u7d20<{0}>\u306f\u30c6\u30f3\u30d7\u30ec\u30fc\u30c8\u30c7\u30fc\u30bf\u3092\u6301\u3064\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093\u3002\u30c6\u30f3\u30d7\u30ec\u30fc\u30c8\u30c7\u30fc\u30bf\u306f\u3001<jsp:text>\u8981\u7d20\u306e\u4e2d\u3067\u96a0\u853d\u3055\u308c\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093\u3002[JSP1.2
PFD
5.1.9]\n\u30c6\u30f3\u30d7\u30ec\u30fc\u30c8\u30c7\u30fc\u30bf\u306e\u30a8\u30e9\u30fc\u3067\u3059:
{1}
-#Error while processing taglib jar file {0}: {1}
-jsp.error.taglib.reserved.prefix=taglib\u30d7\u30ea\u30d5\u30a3\u30af\u30b9 {0}
\u306f\u4e88\u7d04\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.invalid.javaEncoding=\u7121\u52b9\u306aJava\u30a8\u30f3\u30b3\u30fc\u30c7\u30a3\u30f3\u30b0\u3067\u3059\u3002{0}\u3092\u8a66\u3057\u3066\u3001\u305d\u308c\u304b\u3089{1}\u3092\u8a66\u3057\u307e\u3057\u305f\u304c\u3001\u4e21\u65b9\u304c\u5931\u6557\u3057\u307e\u3057\u305f
-jsp.error.needAlternateJavaEncoding=\u30c7\u30d5\u30a9\u30eb\u30c8\u306eJava\u30a8\u30f3\u30b3\u30fc\u30c7\u30a3\u30f3\u30b0
{0}
\u306f\u3042\u306a\u305f\u306e\u30d7\u30e9\u30c3\u30c8\u30d5\u30a9\u30fc\u30e0\u3067\u306f\u7121\u52b9\u3067\u3059\u3002JspServlet\u306e
'javaEncoding'
\u30d1\u30e9\u30e1\u30bf\u3067\u3001\u5225\u306e\u5024\u3092\u6307\u5b9a\u3059\u308b\u3053\u3068\u304c\u3067\u304d\u307e\u3059\u3002
-#Error when compiling, used for jsp line number error messages
-jsp.error.single.line.number=JSP\u30d5\u30a1\u30a4\u30eb: {1}
\u306e\u4e2d\u306e{0}\u884c\u76ee\u3067\u30a8\u30e9\u30fc\u304c\u767a\u751f\u3057\u307e\u3057\u305f
-jsp.error.multiple.line.number=\n\nJPS\u30d5\u30a1\u30a4\u30eb:
{2}\u306e\u4e2d\u306e{0}\u884c\u76ee\u3068{1}\u884c\u76ee\u306e\u9593\u3067\u30a8\u30e9\u30fc\u304c\u767a\u751f\u3057\u307e\u3057\u305f\n\n
-jsp.error.corresponding.servlet=\u751f\u6210\u3055\u308c\u305f\u30b5\u30fc\u30d6\u30ec\u30c3\u30c8\u306e\u30a8\u30e9\u30fc\u3067\u3059:\n
-jsp.error.empty.body.not.allowed={0}
\u306b\u5bfe\u3057\u3066\u7a7a\u306e\u30dc\u30c7\u30a3\u306f\u8a31\u3055\u308c\u307e\u305b\u3093
-jsp.error.jspbody.required=jsp:attribute\u304c\u4f7f\u7528\u3055\u308c\u305f\u5834\u5408\u306b\u306f\u3001{0}\u306b\u30bf\u30b0\u30dc\u30c7\u30a3\u3092\u6307\u5b9a\u3059\u308b\u305f\u3081\u306bjsp:body\u3092\u4f7f\u7528\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspbody.emptybody.only={0}
\u30bf\u30b0\u306f\u3001\u305d\u306e\u30dc\u30c7\u30a3\u4e2d\u306bjsp:attribute\u3060\u3051\u3092\u6301\u3064\u3053\u3068\u304c\u3067\u304d\u307e\u3059
-jsp.error.no.scriptlets=\u30b9\u30af\u30ea\u30d7\u30c6\u30a3\u30f3\u30b0\u8981\u7d20 (
<%!\u3001<jsp:declaration\u3001<%=\u3001<jsp:expression\u3001<%\u3001<jsp:scriptlet
) \u306f\u3053\u3053\u3067\u306f\u8a31\u3055\u308c\u307e\u305b\u3093
-jsp.error.internal.unexpected_node_type=\u5185\u90e8\u30a8\u30e9\u30fc:
\u672a\u77e5\u306e\u30ce\u30fc\u30c9\u30bf\u30a4\u30d7\u304c\u8868\u308c\u307e\u3057\u305f
-jsp.error.tld.fn.invalid.signature=TLD\u306e\u4e2d\u306e\u95a2\u6570\u30b7\u30b0\u30cd\u30c1\u30e3\u306b\u5bfe\u3059\u308b\u7121\u52b9\u306a\u69cb\u6587\u3067\u3059\u3002\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea:
{0}\u3001\u95a2\u6570: {1}
-jsp.error.tld.fn.duplicate.name=\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea {1}
\u306e\u4e2d\u306e\u95a2\u6570\u540d {0} \u304c\u91cd\u8907\u3057\u3066\u3044\u307e\u3059
-jsp.error.tld.fn.invalid.signature.commaexpected=TLD\u306e\u4e2d\u306e\u95a2\u6570\u30b7\u30b0\u30cd\u30c1\u30e3\u306b\u5bfe\u3059\u308b\u7121\u52b9\u306a\u69cb\u6587\u3067\u3059\u3002\u30b3\u30f3\u30de
','
\u304c\u3042\u308a\u307e\u305b\u3093\u3002\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea:
{0}\u3001\u95a2\u6570: {1}\u3002
-jsp.error.tld.fn.invalid.signature.parenexpected=TLD\u306e\u4e2d\u306e\u95a2\u6570\u30b7\u30b0\u30cd\u30c1\u30e3\u306b\u5bfe\u3059\u308b\u7121\u52b9\u306a\u69cb\u6587\u3067\u3059\u3002\u62ec\u5f27
'('
\u304c\u3042\u308a\u307e\u305b\u3093\u3002\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea:
{0}\u3001\u95a2\u6570: {1}\u3002
-jsp.error.tld.mandatory.element.missing=\u5fc5\u9808TLD\u8981\u7d20\u304c\u306a\u3044\u3001\u53c8\u306f\u7a7a\u3067\u3059:
{0}
-jsp.error.dynamic.attributes.not.implemented={0}
\u30bf\u30b0\u306f\u305d\u308c\u304cdynamic\u5c5e\u6027\u3092\u53d7\u3051\u4ed8\u3051\u308b\u3068\u5ba3\u8a00\u3057\u3066\u3044\u307e\u3059\u304c\u3001\u305d\u308c\u306b\u5fc5\u8981\u306a\u30a4\u30f3\u30bf\u30d5\u30a7\u30fc\u30b9\u3092\u5b9f\u88c5\u3057\u3066\u3044\u307e\u305b\u3093
-jsp.error.nomatching.fragment=attribute\u6307\u793a\u5b50
(name={0}\u304a\u3088\u3073fragment=true\u3092\u6301\u3064)
\u304cfragment\u6307\u793a\u5b50\u3088\u308a\u524d\u306b\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.attribute.noequal=\u7b49\u53f7\u8a18\u53f7\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.attribute.noquote=\u5f15\u7528\u7b26\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.attribute.unterminated={0}
\u306e\u5c5e\u6027\u304c\u6b63\u3057\u304f\u7d42\u4e86\u3057\u3066\u3044\u307e\u305b\u3093
-jsp.error.missing.tagInfo={0}
\u306b\u5bfe\u3059\u308bTagInfo\u30aa\u30d6\u30b8\u30a7\u30af\u30c8\u304cTLD\u304b\u3089\u5931\u308f\u308c\u307e\u3057\u305f
-jsp.error.fragmentwithtype='fragment'\u5c5e\u6027\u3068'type'\u5c5e\u6027\u3092\u4e21\u65b9\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093\u3002'fragment'\u304c\u5b58\u5728\u3059\u308b\u5834\u5408\u306b\u306f'type'\u306f'javax.servlet.jsp.tagext.JspFragment'\u306b\u56fa\u5b9a\u3055\u308c\u307e\u3059
-jsp.error.fragmentwithrtexprvalue='fragment'\u5c5e\u6027\u3068'rtexprvalue'\u5c5e\u6027\u3092\u4e21\u65b9\u6307\u5b9a\u3067\u304d\u307e\u305b\u3093\u3002'fragment'\u304c\u5b58\u5728\u3059\u308b\u5834\u5408\u306b\u306f'rtexprvalue'\u306f'true'\u306b\u56fa\u5b9a\u3055\u308c\u307e\u3059
-jsp.error.fragmentWithDeclareOrScope='fragment'\u5c5e\u6027\u3068'declare'\u5c5e\u6027\u306e\u4e21\u65b9\u53c8\u306f'scope'\u5c5e\u6027\u304cvariable\u6307\u793a\u5b50\u4e2d\u3067\u6307\u5b9a\u3055\u308c\u3066\u3044\u307e\u3059
-jsp.error.var_and_varReader=\'var\'\u53c8\u306f\'varReader\'\u306e\u3069\u3061\u3089\u304b\u4e00\u3064\u3092\u6307\u5b9a\u3059\u308b\u3053\u3068\u304c\u3067\u304d\u307e\u3059
-jsp.error.missing_var_or_varReader=\'var\'\u53c8\u306f\'varReader\'\u5c5e\u6027\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.warning.bad.urlpattern.propertygroup=web.xml\u4e2d\u306eurl-pattern\u526f\u8981\u7d20\u4e2d\u306b\u8aa4\u3063\u305f\u5024
{0} \u304c\u3042\u308a\u307e\u3059
-jsp.error.unknown_attribute_type=\u5c5e\u6027 {0}
\u306b\u5bfe\u3059\u308b\u672a\u77e5\u306e\u5c5e\u6027\u30bf\u30a4\u30d7\u3067\u3059
-jsp.error.jspelement.missing.name=\u5fc5\u9808\u306eXML\u30b9\u30bf\u30a4\u30eb\u306e'name'\u5c5e\u6027\u304cjsp:element\u4e2d\u306b\u3042\u308a\u307e\u305b\u3093
-jsp.error.xmlns.redefinition.notimplemented=\u5185\u90e8\u30a8\u30e9\u30fc:
xmlns:{0}\u3092\u518d\u5b9a\u7fa9\u3057\u3088\u3046\u3068\u3057\u307e\u3057\u305f\u3002\u540d\u524d\u7a7a\u9593\u306e\u518d\u5b9a\u7fa9\u306f\u5b9f\u88c5\u3055\u308c\u3066\u3044\u307e\u305b\u3093\u3002
-jsp.error.could.not.add.taglibraries=1\u3064\u4ee5\u4e0a\u306e\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea\u3092\u8ffd\u52a0\u3067\u304d\u307e\u305b\u3093
-jsp.error.duplicate.name.jspattribute=\u6a19\u6e96\u53c8\u306f\u30ab\u30b9\u30bf\u30e0\u30a2\u30af\u30b7\u30e7\u30f3\u4e2d\u3067\u6307\u5b9a\u3055\u308c\u3066\u3044\u308b\u5c5e\u6027
{0}
\u306f\u305d\u308c\u306b\u56f2\u307e\u308c\u305fjsp:attribute\u4e2d\u306ename\u5c5e\u6027\u306e\u5024\u3068\u3057\u3066\u3082\u8868\u308c\u307e\u3059
-jsp.error.not.in.template=\u30c6\u30f3\u30d7\u30ec\u30fc\u30c8\u30c6\u30ad\u30b9\u30c8\u30dc\u30c7\u30a3\u4e2d\u3067\u306f
{0} \u306f\u8a31\u3055\u308c\u307e\u305b\u3093
-jsp.error.badStandardAction=\u7121\u52b9\u306a\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u3067\u3059
-jsp.error.xml.badStandardAction=\u7121\u52b9\u306a\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u3067\u3059:
{0}
-jsp.error.tagdirective.badbodycontent=tag\u6307\u793a\u5b50\u4e2d\u306e\u7121\u52b9\u306abody-content
({0})\u3067\u3059
-jsp.error.simpletag.badbodycontent=\u30af\u30e9\u30b9 {0}
\u306eTLD\u306fSimpleTag\u306b\u7121\u52b9\u306abody-content
(JSP)\u3092\u6307\u5b9a\u3057\u3066\u3044\u307e\u3059
-jsp.error.config_pagedir_encoding_mismatch=jsp-property-group\u4e2d\u306b\u6307\u5b9a\u3055\u308c\u3066\u3044\u308bPage-encoding
({0}) \u304cpage\u6307\u793a\u5b50\u4e2d\u306e\u6307\u5b9a ({1})
\u3068\u9055\u3044\u307e\u3059
-jsp.error.prolog_pagedir_encoding_mismatch=XML\u5c0e\u5165\u90e8\u3067\u6307\u5b9a\u3055\u308c\u305fpage-encoding
({0}) \u304cpage\u6307\u793a\u5b50\u4e2d\u306e\u6307\u5b9a ({1})
\u3068\u9055\u3044\u307e\u3059
-jsp.error.prolog_config_encoding_mismatch=XML\u5c0e\u5165\u90e8\u3067\u6307\u5b9a\u3055\u308c\u305fpage-encoding
({0}) \u304cjsp-property-group\u4e2d\u306e\u6307\u5b9a\u3068\u9055\u3044\u307e\u3059
({1})
-jsp.error.attribute.custom.non_rt_with_expr=TLD\u53c8\u306f\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u4e2d\u306eattribute\u6307\u793a\u5b50\u306b\u5f93\u3063\u3066\u5c5e\u6027{0}\u306f\u3069\u3093\u306a\u5f0f\u3082\u53d7\u3051\u4ed8\u3051\u307e\u305b\u3093
-jsp.error.attribute.standard.non_rt_with_expr={1}
\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u306e {0}
\u5c5e\u6027\u306f\u3069\u3093\u306a\u5f0f\u3082\u53d7\u3051\u4ed8\u3051\u307e\u305b\u3093
-jsp.error.scripting.variable.missing_name=\u5c5e\u6027 {0}
\u304b\u3089\u30b9\u30af\u30ea\u30d7\u30c8\u5909\u6570\u540d\u3092\u6c7a\u5b9a\u3067\u304d\u307e\u305b\u3093
-jasper.error.emptybodycontent.nonempty=TLD\u306b\u5f93\u3063\u3066\u30bf\u30b0 {0}
\u306f\u7a7a\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093\u304c\u3001\u305d\u3046\u3067\u306f\u3042\u308a\u307e\u305b\u3093
-jsp.error.tagfile.nameNotUnique={2}\u884c\u76ee\u306e {0} \u306e\u5024\u3068 {1}
\u306e\u5024\u306f\u540c\u3058\u3067\u3059
-jsp.error.tagfile.nameFrom.noAttribute=\u3053\u306ename-from-attribute\u5c5e\u6027\u306e\u5024\u3067\u3042\u308b\u5024
\"{0}\"
\u306ename\u5c5e\u6027\u3092\u6301\u3064attribute\u6307\u793a\u5b50\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.tagfile.nameFrom.badAttribute=attribute\u6307\u793a\u5b50
({1}\u884c\u76ee\u3067\u5ba3\u8a00\u3055\u308c\u3001\u305d\u306ename\u5c5e\u6027\u304c\"{0}\"\u3001\u3053\u306ename-from-attribute\u5c5e\u6027\u306e\u5024)
\u306fjava.lang.String\u578b\u306e\"required\" \u3067
\"rtexprvalue\".\u3067\u3042\u3063\u3066\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.page.noSession=\u30bb\u30c3\u30b7\u30e7\u30f3\u306b\u52a0\u308f\u3063\u3066\u3044\u306a\u3044\u30da\u30fc\u30b8\u306e\u4e2d\u3067\u306f\u30bb\u30c3\u30b7\u30e7\u30f3\u30b9\u30b3\u30fc\u30d7\u306b\u30a2\u30af\u30bb\u30b9\u3067\u304d\u307e\u305b\u3093
-jsp.error.useBean.noSession=JSP\u30da\u30fc\u30b8\u304c(page\u6307\u793a\u5b50\u306b\u3088\u308a)\u30bb\u30c3\u30b7\u30e7\u30f3\u4e2d\u3067\u5354\u8abf\u3057\u306a\u3044\u3053\u3068\u3092\u5ba3\u8a00\u3057\u3066\u3044\u308b\u6642\u3001\u30bb\u30c3\u30b7\u30e7\u30f3\u30b9\u30b3\u30fc\u30d7\u3092\u4f7f\u7528\u3059\u308b\u305f\u3081\u306euseBean\u304c\u4e0d\u6b63\u3067\u3059
-jsp.error.xml.encodingByteOrderUnsupported =
\u30a8\u30f3\u30b3\u30fc\u30c7\u30a3\u30f3\u30b0 \"{0}\"
\u306b\u6307\u5b9a\u3055\u308c\u305f\u30d0\u30a4\u30c8\u30aa\u30fc\u30c0\u306f\u30b5\u30dd\u30fc\u30c8\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.xml.encodingDeclInvalid =
\u7121\u52b9\u306a\u30a8\u30f3\u30b3\u30fc\u30c7\u30a3\u30f3\u30b0\u540d \"{0}\"
\u3067\u3059
-jsp.error.xml.encodingDeclRequired =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u4e2d\u306b\u30a8\u30f3\u30b3\u30fc\u30c7\u30a3\u30f3\u30b0\u5ba3\u8a00\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.morePseudoAttributes =
\u3088\u308a\u591a\u304f\u306e\u7591\u4f3c\u5c5e\u6027\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.noMorePseudoAttributes =
\u3053\u308c\u4ee5\u4e0a\u306e\u7591\u4f3c\u5c5e\u6027\u306f\u8a31\u3055\u308c\u307e\u305b\u3093
-jsp.error.xml.versionInfoRequired =
XML\u5ba3\u8a00\u306e\u4e2d\u306b\u30d0\u30fc\u30b8\u30e7\u30f3\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.xmlDeclUnterminated =
XML\u5ba3\u8a00\u306f\"?>\"\u3067\u7d42\u3089\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.xml.reservedPITarget =
\"[xX][mM][lL]\"\u306b\u4e00\u81f4\u3059\u308b\u51e6\u7406\u547d\u4ee4\u30bf\u30fc\u30b2\u30c3\u30c8\u306f\u8a31\u3055\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.xml.spaceRequiredInPI =
\u7a7a\u767d\u304c\u51e6\u7406\u547d\u4ee4\u30bf\u30fc\u30b2\u30c3\u30c8\u3068\u30c7\u30fc\u30bf\u306e\u9593\u306b\u5fc5\u8981\u3067\u3059
-jsp.error.xml.invalidCharInContent =
\u30c9\u30ad\u30e5\u30e1\u30f3\u30c8\u306e\u7121\u52b9\u306aXML\u6587\u5b57 (Unicode:
0x{0})
\u304c\u30c9\u30ad\u30e5\u30e1\u30f3\u30c8\u306e\u8981\u7d20\u5185\u5bb9\u306e\u4e2d\u306b\u898b\u3064\u304b\u308a\u307e\u3057\u305f
-jsp.error.xml.spaceRequiredBeforeStandalone =
XML\u5ba3\u8a00\u306eencoding\u7591\u4f3c\u5c5e\u6027\u306e\u524d\u306b\u7a7a\u767d\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.sdDeclInvalid =
\u30b9\u30bf\u30f3\u30c9\u30a2\u30ed\u30f3\u6587\u66f8\u5ba3\u8a00\u5024\u306f\"yes\"\u53c8\u306f\"no\"\u306e\u3069\u3061\u3089\u304b\u3067\u3042\u308a\u3001\"{0}\"\u3067\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.xml.invalidCharInPI = \u7121\u52b9\u306aXML\u6587\u5b57 (Unicode: 0x{0})
\u304c\u547d\u4ee4\u51e6\u7406\u4e2d\u306b\u898b\u3064\u304b\u308a\u307e\u3057\u305f
-jsp.error.xml.versionNotSupported = XML\u30d0\u30fc\u30b8\u30e7\u30f3 \"{0}\"
\u306f\u30b5\u30dd\u30fc\u30c8\u3055\u308c\u3066\u3044\u307e\u305b\u3093\u3001XML
1.0\u3060\u3051\u3092\u30b5\u30dd\u30fc\u30c8\u3057\u3066\u3044\u307e\u3059
-jsp.error.xml.pseudoAttrNameExpected =
\u7591\u4f3c\u5c5e\u6027\u540d\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.expectedByte
={1}\u30d0\u30a4\u30c8UTF-8\u30b7\u30fc\u30b1\u30f3\u30b9\u306e\u30d0\u30a4\u30c8 {0}
\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.invalidByte =
{1}\u30d0\u30a4\u30c8UTF-8\u30b7\u30fc\u30b1\u30f3\u30b9\u306e\u7121\u52b9\u306a\u30d0\u30a4\u30c8
{0} \u3067\u3059
-jsp.error.xml.operationNotSupported = {1} reader\u306f\u64cd\u4f5c \"{0}\"
\u3092\u30b5\u30dd\u30fc\u30c8\u3057\u3066\u3044\u307e\u305b\u3093
-jsp.error.xml.invalidHighSurrogate =
UTF-8\u30b7\u30fc\u30b1\u30f3\u30b9\u306e\u30cf\u30a4\u30b5\u30ed\u30b2\u30fc\u30c8\u30d3\u30c3\u30c8\u306f0x10\u3092\u8d8a\u3048\u3066\u306f\u3044\u3051\u307e\u305b\u3093\u304c\u30010x{0}\u304c\u898b\u3064\u304b\u308a\u307e\u3057\u305f
-jsp.error.xml.invalidASCII = \u30d0\u30a4\u30c8 \"{0}\"
\u306f7\u30d3\u30c3\u30c8ASCII\u3067\u306f\u3042\u308a\u307e\u305b\u3093
-jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl =
XML\u5ba3\u8a00\u306eencoding\u7591\u4f3c\u5c5e\u6027\u306e\u524d\u306b\u7a7a\u767d\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u306eencoding\u7591\u4f3c\u5c5e\u6027\u306e\u524d\u306b\u7a7a\u767d\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.spaceRequiredBeforeVersionInTextDecl =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u306eversion\u7591\u4f3c\u5c5e\u6027\u306e\u524d\u306b\u7a7a\u767d\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl =
XML\u5ba3\u8a00\u306eversion\u7591\u4f3c\u5c5e\u6027\u306e\u524d\u306b\u7a7a\u767d\u304c\u5fc5\u8981\u3067\u3059
-jsp.error.xml.eqRequiredInXMLDecl =
XML\u5ba3\u8a00\u4e2d\u3067\"{0}\"\u306e\u6b21\u306b'' = ''
\u6587\u5b57\u304c\u7d9a\u304b\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.xml.eqRequiredInTextDecl =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u4e2d\u3067\"{0}\"\u306e\u6b21\u306b''
=
''\u6587\u5b57\u304c\u7d9a\u304b\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.xml.quoteRequiredInTextDecl =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u4e2d\u306e\"{0}\"\u306b\u7d9a\u304f\u5024\u306f\u30af\u30aa\u30fc\u30c8\u3067\u56f2\u307e\u308c\u305f\u6587\u5b57\u5217\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.xml.quoteRequiredInXMLDecl =
XML\u5ba3\u8a00\u4e2d\u306e\"{0}\"\u306b\u7d9a\u304f\u5024\u306f\u30af\u30aa\u30fc\u30c8\u3067\u56f2\u307e\u308c\u305f\u6587\u5b57\u5217\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.xml.invalidCharInTextDecl =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u306e\u4e2d\u306b\u7121\u52b9\u306aXML\u6587\u5b57
(Unicode: 0x{0}) \u304c\u898b\u3064\u304b\u308a\u307e\u3057\u305f
-jsp.error.xml.invalidCharInXMLDecl =
XML\u5ba3\u8a00\u306e\u4e2d\u306b\u7121\u52b9\u306aXML\u6587\u5b57 (Unicode: 0x{0})
\u304c\u898b\u3064\u304b\u308a\u307e\u3057\u305f
-jsp.error.xml.closeQuoteMissingInTextDecl =
\u30c6\u30ad\u30b9\u30c8\u5ba3\u8a00\u4e2d\u306e\"{0}\"\u306b\u7d9a\u304f\u5024\u306e\u4e2d\u306e\u6700\u5f8c\u306e\u30af\u30aa\u30fc\u30c8\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.xml.closeQuoteMissingInXMLDecl =
XML\u5ba3\u8a00\u4e2d\u306e\"{0}\"\u306b\u7d9a\u304f\u5024\u306e\u4e2d\u306e\u6700\u5f8c\u306e\u30af\u30aa\u30fc\u30c8\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.xml.invalidHighSurrogate =
UTF-8\u30b7\u30fc\u30b1\u30f3\u30b9\u306e\u30cf\u30a4\u30b5\u30ed\u30b2\u30fc\u30c8\u30d3\u30c3\u30c8\u306f0x10\u3092\u8d8a\u3048\u3066\u306f\u3044\u3051\u307e\u305b\u3093\u304c\u30010x{0}\u304c\u898b\u3064\u304b\u308a\u307e\u3057\u305f
-jsp.error.multiple.jsp =
\u8907\u6570\u306e\u4ed5\u69d8\u3092\u6e80\u305f\u3059\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.jspoutput.conflict=<jsp:output>:
\"{0}\"\u306b\u7570\u306a\u308b\u5024\u3092\u8907\u6570\u56de\u6307\u5b9a\u3059\u308b\u306e\u306f\u7121\u52b9\u3067\u3059
(\u65e7: {1}, \u65b0: {2})
-jsp.error.jspoutput.doctypenamesystem=<jsp:output>:
'doctype-root-element' \u53ca\u3073 'doctype-system'
\u5c5e\u6027\u306f\u540c\u6642\u306b\u6307\u5b9a\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspoutput.doctypepulicsystem=<jsp:output>:
'doctype-public'\u5c5e\u6027\u3092\u6307\u5b9a\u3059\u308b\u5834\u5408\u306f\u3001'doctype-system'
\u5c5e\u6027\u3082\u6307\u5b9a\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspoutput.nonemptybody=<jsp:output>
\u30dc\u30c7\u30a3\u3092\u6301\u3063\u3066\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.jspoutput.invalidUse=<jsp:output>
\u6a19\u6e96\u69cb\u6587\u306e\u4e2d\u3067\u4f7f\u7528\u3057\u3066\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.attributes.not.allowed = {0}
\u306f\u5c5e\u6027\u3092\u6301\u3064\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.tagfile.badSuffix=\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u30d1\u30b9 {0}
\u306e\u4e2d\u306b\".tag\"
\u62e1\u5f35\u5b50\u304c\u3042\u308a\u307e\u305b\u3093
-jsp.error.tagfile.illegalPath=\u4e0d\u6b63\u306a\u30bf\u30b0\u30d5\u30a1\u30a4\u30eb\u30d1\u30b9\u3067\u3059:
{0}\u3001\u3053\u308c\u306f\"/WEB-INF/tags\"\u53c8\u306f\"/META-INF/tags\"\u3067\u59cb\u307e\u3089\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.plugin.wrongRootElement={0}
\u306e\u4e2d\u306e\u30eb\u30fc\u30c8\u8981\u7d20\u306e\u540d\u524d\u306f {1}
\u3067\u306f\u3042\u308a\u307e\u305b\u3093
-jsp.error.attribute.invalidPrefix=\u5c5e\u6027\u306e\u30d7\u30ec\u30d5\u30a3\u30c3\u30af\u30b9
{0}
\u306f\u3069\u306e\u53d6\u308a\u8fbc\u307e\u308c\u305f\u30bf\u30b0\u30e9\u30a4\u30d6\u30e9\u30ea\u306b\u3082\u5bfe\u5fdc\u3057\u307e\u305b\u3093
-jsp.error.nested.jspattribute=jsp:attribute\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u306f\u5225\u306ejsp:attribute\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u306e\u7bc4\u56f2\u5185\u3067\u30cd\u30b9\u30c8\u3059\u308b\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.nested.jspbody=jsp:body\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u306f\u5225\u306ejsp:body\u53c8\u306fjsp:attribute\u6a19\u6e96\u30a2\u30af\u30b7\u30e7\u30f3\u306e\u7bc4\u56f2\u5185\u3067\u30cd\u30b9\u30c8\u3059\u308b\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.variable.either.name=name-given\u53c8\u306fname-from-attribute\u5c5e\u6027\u306e\u3069\u3061\u3089\u304b\u3092variable\u6307\u793a\u5b50\u306e\u4e2d\u3067\u6307\u5b9a\u3055\u308c\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.variable.both.name=variable\u6307\u793a\u5b50\u4e2d\u3067name-given\u3068name-from-attribute\u5c5e\u6027\u306e\u4e21\u65b9\u3092\u6307\u5b9a\u3059\u308b\u3053\u3068\u306f\u3067\u304d\u307e\u305b\u3093
-jsp.error.variable.alias=name-from-attribute\u304a\u3088\u3073alias\u5c5e\u6027\u306e\u4e21\u65b9\u3092variable\u6307\u793a\u5b50\u4e2d\u306b\u6307\u5b9a\u3059\u308b\u3001\u53c8\u306f\u3069\u3061\u3089\u3082\u6307\u5b9a\u3057\u306a\u3044\u3053\u3068\u304c\u3067\u304d\u307e\u3059
-jsp.error.attribute.null_name=\u7a7a\u306e\u5c5e\u6027\u540d\u3067\u3059
-jsp.error.jsptext.badcontent=\'<\'\u304c<jsp:text>\u306e\u30dc\u30c7\u30a3\u306e\u4e2d\u306b\u73fe\u308c\u308b\u6642\u306f\u3001CDATA\u306e\u4e2d\u306b\u96a0\u853d\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.jsproot.version.invalid=\u7121\u52b9\u306a\u30d0\u30fc\u30b8\u30e7\u30f3\u756a\u53f7\u3067\u3059:
\"{0}\"\u3001\"1.2\" \u53c8\u306f
\"2.0\"\u3000\u3067\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.noFunctionPrefix=\u30c7\u30d5\u30a9\u30eb\u30c8\u306e\u540d\u524d\u7a7a\u9593\u304c\u6307\u5b9a\u3055\u308c\u3066\u3044\u306a\u3044\u6642\u306b\u306f\u3001\u95a2\u6570
{0}
\u306f\u30d7\u30ea\u30d5\u30a3\u30af\u30b9\u4ed8\u304d\u3067\u4f7f\u7528\u3057\u306a\u3051\u308c\u3070\u3044\u3051\u307e\u305b\u3093
-jsp.error.noFunction=\u95a2\u6570 {0}
\u3092\u6307\u5b9a\u3055\u308c\u305f\u30d7\u30ea\u30d5\u30a3\u30af\u30b9\u3067\u914d\u7f6e\u3067\u304d\u307e\u305b\u3093
-jsp.error.noFunctionMethod=\u95a2\u6570 \"{1}\" \u306e\u30e1\u30bd\u30c3\u30c9
\"{0}\" \u304c \"{2}\"
\u4e2d\u3067\u898b\u3064\u304b\u308a\u307e\u305b\u3093
-jsp.error.function.classnotfound=TLD\u306e\u4e2d\u3067\u95a2\u6570 {1}
\u306b\u6307\u5b9a\u3055\u308c\u3066\u3044\u308b\u30af\u30e9\u30b9 {0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093: {2}
-jsp.error.signature.classnotfound=TLD\u306e\u4e2d\u306e\u30e1\u30bd\u30c3\u30c9\u30b7\u30b0\u30cd\u30c1\u30e3\u3067\u95a2\u6570
{1} \u306b\u6307\u5b9a\u3055\u308c\u3066\u3044\u308b\u30af\u30e9\u30b9 {0}
\u304c\u898b\u3064\u304b\u308a\u307e\u305b\u3093\u3002 {2}
-jsp.error.text.has_subelement=<jsp:text>
\u306f\u526f\u8981\u7d20\u3092\u6301\u3063\u3066\u306f\u3044\u3051\u307e\u305b\u3093
-jsp.error.data.file.read=\u30d5\u30a1\u30a4\u30eb \"{0}\"
\u3092\u8aad\u307f\u8fbc\u307f\u4e2d\u306b\u30a8\u30e9\u30fc\u304c\u767a\u751f\u3057\u307e\u3057\u305f
-jsp.error.prefix.refined=\u30d7\u30ea\u30d5\u30a3\u30c3\u30af\u30b9 {0}
\u304c\u73fe\u5728\u306e\u30b9\u30b3\u30fc\u30d7\u4e2d\u3067\u65e2\u306b {2}
\u3068\u5b9a\u7fa9\u3055\u308c\u3066\u3044\u308b\u306e\u3067 {1}
\u306b\u518d\u5b9a\u7fa9\u3057\u307e\u3057\u305f
-jsp.error.nested_jsproot=\u5165\u308c\u5b50\u306b\u306a\u3063\u305f
<jsp:root> \u3067\u3059
-jsp.error.unbalanced.endtag=\u7d42\u4e86\u30bf\u30b0 \"</{0}\"
\u306e\u5bfe\u5fdc\u304c\u53d6\u308c\u3066\u3044\u307e\u305b\u3093
-jsp.error.invalid.bean=useBean\u306e\u30af\u30e9\u30b9\u5c5e\u6027 {0}
\u306e\u5024\u304c\u7121\u52b9\u3067\u3059
-jsp.error.prefix.use_before_dcl=\u3053\u306e\u30bf\u30b0\u6307\u793a\u5b50\u3067\u6307\u5b9a\u3055\u308c\u3066\u3044\u308b\u30d7\u30ea\u30d5\u30a3\u30c3\u30af\u30b9
{0} \u306f\u3001\u3059\u3067\u306b\u30d5\u30a1\u30a4\u30eb {1} \u306e {2}
\u884c\u76ee\u306e\u30a2\u30af\u30b7\u30e7\u30f3\u3067\u4f7f\u7528\u3055\u308c\u3066\u3044\u307e\u3059
-
Modified: trunk/src/main/java/org/apache/jasper/runtime/HttpJspBase.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/runtime/HttpJspBase.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/runtime/HttpJspBase.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.runtime;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.IOException;
import javax.servlet.ServletConfig;
@@ -25,10 +27,7 @@
import javax.servlet.http.HttpServletRequest;
import javax.servlet.http.HttpServletResponse;
import javax.servlet.jsp.HttpJspPage;
-import javax.servlet.jsp.JspFactory;
-import org.apache.jasper.compiler.Localizer;
-
/**
* This is the super class of all JSP-generated servlets.
*
@@ -53,7 +52,7 @@
}
public String getServletInfo() {
- return Localizer.getMessage("jsp.engine.info");
+ return MESSAGES.jspInfo();
}
public final void destroy() {
Modified: trunk/src/main/java/org/apache/jasper/runtime/JspContextWrapper.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/runtime/JspContextWrapper.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/runtime/JspContextWrapper.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.runtime;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.IOException;
import java.io.Writer;
import java.util.ArrayList;
@@ -42,7 +44,6 @@
import javax.servlet.jsp.tagext.BodyContent;
import javax.servlet.jsp.tagext.VariableInfo;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.util.Enumerator;
/**
@@ -101,8 +102,7 @@
public Object getAttribute(String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
return pageAttributes.get(name);
@@ -111,8 +111,7 @@
public Object getAttribute(String name, int scope) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (scope == PAGE_SCOPE) {
@@ -125,8 +124,7 @@
public void setAttribute(String name, Object value) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (value != null) {
@@ -139,8 +137,7 @@
public void setAttribute(String name, Object value, int scope) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (scope == PAGE_SCOPE) {
@@ -157,8 +154,7 @@
public Object findAttribute(String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
Object o = pageAttributes.get(name);
@@ -180,8 +176,7 @@
public void removeAttribute(String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
pageAttributes.remove(name);
@@ -195,8 +190,7 @@
public void removeAttribute(String name, int scope) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (scope == PAGE_SCOPE) {
@@ -209,8 +203,7 @@
public int getAttributesScope(String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (pageAttributes.get(name) != null) {
Modified: trunk/src/main/java/org/apache/jasper/runtime/JspRuntimeLibrary.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/runtime/JspRuntimeLibrary.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/runtime/JspRuntimeLibrary.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.runtime;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.beans.PropertyEditor;
import java.beans.PropertyEditorManager;
import java.io.ByteArrayOutputStream;
@@ -39,7 +41,6 @@
import org.apache.jasper.Constants;
import org.apache.jasper.JasperException;
-import org.apache.jasper.compiler.Localizer;
/**
* Bunch of util methods that are used by code generated for useBean,
@@ -336,8 +337,7 @@
if ( method != null ) {
if (type.isArray()) {
if (request == null) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.setproperty.noindexset"));
+ throw new JasperException(MESSAGES.failedSettingBeanIndexedProperty());
}
Class t = type.getComponentType();
String[] values = request.getParameterValues(param);
@@ -362,16 +362,9 @@
}
if (!ignoreMethodNF && (method == null)) {
if (type == null) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.noproperty",
- prop,
- bean.getClass().getName()));
+ throw new JasperException(MESSAGES.cannotFindBeanProperty(prop,
bean.getClass().getName()));
} else {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.nomethod.setproperty",
- prop,
- type.getName(),
- bean.getClass().getName()));
+ throw new JasperException(MESSAGES.cannotSetBeanProperty(prop,
type.getName(), bean.getClass().getName()));
}
}
}
@@ -600,8 +593,7 @@
public static Object handleGetProperty(Object o, String prop)
throws JasperException {
if (o == null) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.nullbean"));
+ throw new JasperException(MESSAGES.nullBean());
}
Object value = null;
try {
@@ -783,25 +775,16 @@
}
} else {
// just in case introspection silently fails.
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.nobeaninfo",
- beanClass.getName()));
+ throw new
JasperException(MESSAGES.cannotFindBeanInfo(beanClass.getName()));
}
} catch (Exception ex) {
throw new JasperException (ex);
}
if (method == null) {
if (type == null) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.noproperty",
- prop,
- beanClass.getName()));
+ throw new JasperException(MESSAGES.cannotFindBeanProperty(prop,
beanClass.getName()));
} else {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.nomethod.setproperty",
- prop,
- type.getName(),
- beanClass.getName()));
+ throw new JasperException(MESSAGES.cannotSetBeanProperty(prop,
type.getName(), beanClass.getName()));
}
}
return method;
@@ -827,22 +810,16 @@
}
} else {
// just in case introspection silently fails.
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.nobeaninfo",
- beanClass.getName()));
+ throw new JasperException(MESSAGES.cannotFindBeanInfo(beanClass.getName()));
}
} catch (Exception ex) {
throw new JasperException (ex);
}
if (method == null) {
if (type == null) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.noproperty", prop,
- beanClass.getName()));
+ throw new JasperException(MESSAGES.cannotFindBeanProperty(prop,
beanClass.getName()));
} else {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.nomethod", prop,
- beanClass.getName()));
+ throw new JasperException(MESSAGES.cannotGetBeanProperty(prop,
beanClass.getName()));
}
}
@@ -862,10 +839,8 @@
pe.setAsText(attrValue);
return pe.getValue();
} catch (Exception ex) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.property.conversion",
- attrValue, attrClass.getName(), attrName,
- ex.getMessage()));
+ throw new JasperException(MESSAGES.errorConvertingBeanProperty
+ (attrValue, attrClass.getName(), attrName, ex.getMessage()));
}
}
@@ -880,14 +855,11 @@
propEditor.setAsText(attrValue);
return propEditor.getValue();
} else {
- throw new IllegalArgumentException(
-
Localizer.getMessage("jsp.error.beans.propertyeditor.notregistered"));
+ throw MESSAGES.noRegisteredPropertyEditor();
}
} catch (IllegalArgumentException ex) {
- throw new JasperException(
- Localizer.getMessage("jsp.error.beans.property.conversion",
- attrValue, attrClass.getName(), attrName,
- ex.getMessage()));
+ throw new JasperException(MESSAGES.errorConvertingBeanProperty
+ (attrValue, attrClass.getName(), attrName, ex.getMessage()));
}
}
Modified: trunk/src/main/java/org/apache/jasper/runtime/JspWriterImpl.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/runtime/JspWriterImpl.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/runtime/JspWriterImpl.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.runtime;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.IOException;
import java.io.Writer;
import java.security.AccessController;
@@ -26,7 +28,6 @@
import javax.servlet.jsp.JspWriter;
import org.apache.jasper.Constants;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.security.SecurityUtil;
/**
@@ -126,43 +127,28 @@
}
}
- private String getLocalizeMessage(final String message){
- if (SecurityUtil.isPackageProtectionEnabled()){
- return (String)AccessController.doPrivileged(new PrivilegedAction(){
- public Object run(){
- return Localizer.getMessage(message);
- }
- });
- } else {
- return Localizer.getMessage(message);
- }
- }
-
/**
* Discard the output buffer.
*/
public final void clear() throws IOException {
if ((bufferSize == 0) && (out != null))
// clear() is illegal after any unbuffered output (JSP.5.5)
- throw new IllegalStateException(
- getLocalizeMessage("jsp.error.ise_on_clear"));
+ throw MESSAGES.cannotClearWithNoBuffer();
if (flushed)
- throw new IOException(
-
getLocalizeMessage("jsp.error.attempt_to_clear_flushed_buffer"));
+ throw MESSAGES.cannotClearAfterFlush();
ensureOpen();
nextChar = 0;
}
public void clearBuffer() throws IOException {
if (bufferSize == 0)
- throw new IllegalStateException(
- getLocalizeMessage("jsp.error.ise_on_clear"));
+ throw MESSAGES.cannotClearWithNoBuffer();
ensureOpen();
nextChar = 0;
}
private final void bufferOverflow() throws IOException {
- throw new IOException(getLocalizeMessage("jsp.error.overflow"));
+ throw MESSAGES.bufferOverflow();
}
/**
Modified: trunk/src/main/java/org/apache/jasper/runtime/PageContextImpl.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/runtime/PageContextImpl.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/runtime/PageContextImpl.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.runtime;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.IOException;
import java.io.Writer;
import java.security.AccessController;
@@ -48,7 +50,6 @@
import javax.servlet.jsp.tagext.BodyContent;
import org.apache.jasper.Constants;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.el.ELContextImpl;
import org.apache.jasper.el.ExpressionEvaluatorImpl;
import org.apache.jasper.el.FunctionMapperImpl;
@@ -188,8 +189,7 @@
((JspWriterImpl) out).flushBuffer();
}
} catch (IOException ex) {
- IllegalStateException ise = new
IllegalStateException(Localizer.getMessage("jsp.error.flush"), ex);
- throw ise;
+ throw MESSAGES.errorFlushingData(ex);
} finally {
servlet = null;
config = null;
@@ -209,8 +209,7 @@
public Object getAttribute(final String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
@@ -232,8 +231,7 @@
public Object getAttribute(final String name, final int scope) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
@@ -258,8 +256,7 @@
case SESSION_SCOPE:
if (session == null) {
- throw new IllegalStateException(Localizer
- .getMessage("jsp.error.page.noSession"));
+ throw MESSAGES.cannotUseSessionScope();
}
return session.getAttribute(name);
@@ -267,15 +264,14 @@
return context.getAttribute(name);
default:
- throw new IllegalArgumentException("Invalid scope");
+ throw MESSAGES.invalidScope();
}
}
public void setAttribute(final String name, final Object attribute) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
@@ -301,8 +297,7 @@
public void setAttribute(final String name, final Object o, final int scope) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
@@ -331,8 +326,7 @@
case SESSION_SCOPE:
if (session == null) {
- throw new IllegalStateException(Localizer
- .getMessage("jsp.error.page.noSession"));
+ throw MESSAGES.cannotUseSessionScope();
}
session.setAttribute(name, o);
break;
@@ -342,7 +336,7 @@
break;
default:
- throw new IllegalArgumentException("Invalid scope");
+ throw MESSAGES.invalidScope();
}
} else {
removeAttribute(name, scope);
@@ -352,8 +346,7 @@
public void removeAttribute(final String name, final int scope) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
AccessController.doPrivileged(new PrivilegedAction() {
@@ -379,8 +372,7 @@
case SESSION_SCOPE:
if (session == null) {
- throw new IllegalStateException(Localizer
- .getMessage("jsp.error.page.noSession"));
+ throw MESSAGES.cannotUseSessionScope();
}
session.removeAttribute(name);
break;
@@ -390,15 +382,14 @@
break;
default:
- throw new IllegalArgumentException("Invalid scope");
+ throw MESSAGES.invalidScope();
}
}
public int getAttributesScope(final String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
@@ -441,8 +432,7 @@
return AccessController.doPrivileged(new PrivilegedAction() {
public Object run() {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
return doFindAttribute(name);
@@ -450,8 +440,7 @@
});
} else {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
return doFindAttribute(name);
@@ -505,8 +494,7 @@
case SESSION_SCOPE:
if (session == null) {
- throw new IllegalStateException(Localizer
- .getMessage("jsp.error.page.noSession"));
+ throw MESSAGES.cannotUseSessionScope();
}
return session.getAttributeNames();
@@ -514,15 +502,14 @@
return context.getAttributeNames();
default:
- throw new IllegalArgumentException("Invalid scope");
+ throw MESSAGES.invalidScope();
}
}
public void removeAttribute(final String name) {
if (name == null) {
- throw new NullPointerException(Localizer
- .getMessage("jsp.error.attribute.null_name"));
+ throw MESSAGES.nullAttributeName();
}
if (SecurityUtil.isPackageProtectionEnabled()) {
@@ -685,10 +672,7 @@
try {
out.clear();
} catch (IOException ex) {
- IllegalStateException ise = new IllegalStateException(Localizer
- .getMessage("jsp.error.attempt_to_clear_flushed_buffer"));
- ise.initCause(ex);
- throw ise;
+ throw MESSAGES.illegalClearAfterFlush(ex);
}
// Make sure that the response object is not the wrapper for include
Modified: trunk/src/main/java/org/apache/jasper/servlet/JspServlet.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/servlet/JspServlet.java 2012-09-14 12:33:07 UTC
(rev 2082)
+++ trunk/src/main/java/org/apache/jasper/servlet/JspServlet.java 2012-09-21 14:14:07 UTC
(rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.servlet;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.IOException;
import java.lang.reflect.Constructor;
@@ -31,10 +33,9 @@
import org.apache.jasper.EmbeddedServletOptions;
import org.apache.jasper.Options;
import org.apache.jasper.compiler.JspRuntimeContext;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.security.SecurityUtil;
import org.apache.tomcat.PeriodicEventListener;
-import org.jboss.logging.Logger;
+import org.jboss.web.JasperLogger;
/**
* The JSP engine (a.k.a Jasper).
@@ -54,9 +55,6 @@
*/
public class JspServlet extends HttpServlet implements PeriodicEventListener {
- // Logger
- private Logger log = Logger.getLogger(JspServlet.class);
-
private ServletContext context;
private ServletConfig config;
private Options options;
@@ -91,8 +89,7 @@
Object[] args = { config, context };
options = (Options) ctor.newInstance(args);
} catch (Throwable e) {
- // Need to localize this.
- log.warn("Failed to load engineOptionsClass", e);
+ JasperLogger.SERVLET_LOGGER.failedLoadingOptions(engineOptionsName,
e);
// Use the default Options implementation
options = new EmbeddedServletOptions(config, context);
}
@@ -102,12 +99,6 @@
}
}
rctxt = new JspRuntimeContext(context, options);
-
- if (log.isDebugEnabled()) {
- log.debug(Localizer.getMessage("jsp.message.scratch.dir.is",
- options.getScratchDir().toString()));
-
log.debug(Localizer.getMessage("jsp.message.dont.modify.servlets"));
- }
}
@@ -264,10 +255,6 @@
}
public void destroy() {
- if (log.isDebugEnabled()) {
- log.debug("JspServlet.destroy()");
- }
-
rctxt.destroy();
}
@@ -298,7 +285,7 @@
if (includeRequestUri != null) {
// This file was included. Throw an exception as
// a response.sendError() will be ignored
- String msg =
Localizer.getMessage("jsp.error.file.not.found", jspUri);
+ String msg = MESSAGES.fileNotFound(jspUri);
// Strictly, filtering this is an application
// responsibility but just in case...
throw new ServletException(SecurityUtil.filter(msg));
@@ -308,9 +295,7 @@
HttpServletResponse.SC_NOT_FOUND,
request.getRequestURI());
} catch (IllegalStateException ise) {
- log.error(Localizer.getMessage(
- "jsp.error.file.not.found",
- jspUri));
+ JasperLogger.SERVLET_LOGGER.fileNotFound(jspUri);
}
}
return;
Modified: trunk/src/main/java/org/apache/jasper/servlet/JspServletWrapper.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/servlet/JspServletWrapper.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/servlet/JspServletWrapper.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -17,6 +17,8 @@
package org.apache.jasper.servlet;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.FileNotFoundException;
import java.io.IOException;
import java.net.URL;
@@ -37,12 +39,10 @@
import org.apache.jasper.compiler.ErrorDispatcher;
import org.apache.jasper.compiler.JavacErrorDetail;
import org.apache.jasper.compiler.JspRuntimeContext;
-import org.apache.jasper.compiler.Localizer;
import org.apache.jasper.runtime.InstanceManagerFactory;
import org.apache.jasper.runtime.JspSourceDependent;
import org.apache.tomcat.InstanceManager;
-import org.jboss.logging.Logger;
-import org.jboss.logging.Logger;
+import org.jboss.web.JasperLogger;
/**
* The JSP engine (a.k.a Jasper).
@@ -64,9 +64,6 @@
public class JspServletWrapper {
- // Logger
- private Logger log = Logger.getLogger(JspServletWrapper.class);
-
private Servlet theServlet;
private String jspUri;
private Class tagHandlerClass;
@@ -291,9 +288,8 @@
if ((available > 0L) && (available < Long.MAX_VALUE)) {
if (available > System.currentTimeMillis()) {
response.setDateHeader("Retry-After", available);
- response.sendError
- (HttpServletResponse.SC_SERVICE_UNAVAILABLE,
- Localizer.getMessage("jsp.error.unavailable"));
+ response.sendError(HttpServletResponse.SC_SERVICE_UNAVAILABLE,
+ MESSAGES.unavailable());
return;
} else {
// Wait period has expired. Reset.
@@ -423,8 +419,7 @@
instanceManager.destroyInstance(theServlet);
} catch (Exception e) {
// Log any exception, since it can't be passed along
- log.error(Localizer.getMessage("jsp.error.file.not.found",
- e.getMessage()), e);
+ JasperLogger.SERVLET_LOGGER.errorDestroyingServletInstance(e);
}
}
}
@@ -495,16 +490,11 @@
}
if (options.getDisplaySourceFragment()) {
- return new JasperException(Localizer.getMessage
- ("jsp.exception", detail.getJspFileName(),
- "" + jspLineNumber) +
- "\n\n" + detail.getJspExtract() +
- "\n\nStacktrace:", ex);
+ return new
JasperException(MESSAGES.jspExceptionWithDetails(detail.getJspFileName(),
+ jspLineNumber, detail.getJspExtract()), ex);
} else {
- return new JasperException(Localizer.getMessage
- ("jsp.exception", detail.getJspFileName(),
- "" + jspLineNumber), ex);
+ return new
JasperException(MESSAGES.jspException(detail.getJspFileName(), jspLineNumber), ex);
}
}
} catch (Exception je) {
Modified: trunk/src/main/java/org/apache/jasper/xmlparser/ASCIIReader.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/xmlparser/ASCIIReader.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/xmlparser/ASCIIReader.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -17,10 +17,11 @@
package org.apache.jasper.xmlparser;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.InputStream;
import java.io.IOException;
import java.io.Reader;
-import org.apache.jasper.compiler.Localizer;
/**
* A simple ASCII byte reader. This is an optimized reader for reading
@@ -86,8 +87,7 @@
public int read() throws IOException {
int b0 = fInputStream.read();
if (b0 > 0x80) {
- throw new
IOException(Localizer.getMessage("jsp.error.xml.invalidASCII",
- Integer.toString(b0)));
+ throw MESSAGES.invalidByteRead(b0);
}
return b0;
} // read():int
@@ -114,8 +114,7 @@
for (int i = 0; i < count; i++) {
int b0 = (0xff & fBuffer[i]); // Convert to unsigned
if (b0 > 0x80) {
- throw new
IOException(Localizer.getMessage("jsp.error.xml.invalidASCII",
- Integer.toString(b0)));
+ throw MESSAGES.invalidByteRead(b0);
}
ch[offset + i] = (char)b0;
}
Modified: trunk/src/main/java/org/apache/jasper/xmlparser/UTF8Reader.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/xmlparser/UTF8Reader.java 2012-09-14 12:33:07
UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/xmlparser/UTF8Reader.java 2012-09-21 14:14:07
UTC (rev 2083)
@@ -17,11 +17,12 @@
package org.apache.jasper.xmlparser;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.InputStream;
import java.io.IOException;
import java.io.Reader;
import java.io.UTFDataFormatException;
-import org.apache.jasper.compiler.Localizer;
/**
* @author Andy Clark, IBM
@@ -31,9 +32,6 @@
public class UTF8Reader
extends Reader {
- private org.jboss.logging.Logger log=
- org.jboss.logging.Logger.getLogger( UTF8Reader.class );
-
//
// Constants
//
@@ -41,11 +39,6 @@
/** Default byte buffer size (2048). */
public static final int DEFAULT_BUFFER_SIZE = 2048;
- // debugging
-
- /** Debug read. */
- private static final boolean DEBUG_READ = false;
-
//
// Data
//
@@ -207,11 +200,6 @@
fSurrogate = -1;
}
- // return character
- if (DEBUG_READ) {
- if (log.isDebugEnabled())
- log.debug("read(): 0x"+Integer.toHexString(c));
- }
return c;
} // read():int
@@ -492,11 +480,6 @@
invalidByte(1, 1, b0);
}
- // return number of characters converted
- if (DEBUG_READ) {
- if (log.isDebugEnabled())
- log.debug("read(char[],"+offset+','+length+"):
count="+count);
- }
return count;
} // read(char[],int,int)
@@ -565,9 +548,7 @@
* or if some other I/O error occurs
*/
public void mark(int readAheadLimit) throws IOException {
- throw new IOException(
- Localizer.getMessage("jsp.error.xml.operationNotSupported",
- "mark()", "UTF-8"));
+ throw MESSAGES.markNotSupportedInUtf8Reader();
}
/**
@@ -606,30 +587,18 @@
/** Throws an exception for expected byte. */
private void expectedByte(int position, int count)
throws UTFDataFormatException {
-
- throw new UTFDataFormatException(
- Localizer.getMessage("jsp.error.xml.expectedByte",
- Integer.toString(position),
- Integer.toString(count)));
-
+ throw new UTFDataFormatException(MESSAGES.errorUtf8ExpectedByte(position,
count));
} // expectedByte(int,int,int)
/** Throws an exception for invalid byte. */
private void invalidByte(int position, int count, int c)
throws UTFDataFormatException {
-
- throw new UTFDataFormatException(
- Localizer.getMessage("jsp.error.xml.invalidByte",
- Integer.toString(position),
- Integer.toString(count)));
+ throw new UTFDataFormatException(MESSAGES.errorUtf8InvalidByte(position,
count));
} // invalidByte(int,int,int,int)
/** Throws an exception for invalid surrogate bits. */
private void invalidSurrogate(int uuuuu) throws UTFDataFormatException {
-
- throw new UTFDataFormatException(
- Localizer.getMessage("jsp.error.xml.invalidHighSurrogate",
- Integer.toHexString(uuuuu)));
+ throw new
UTFDataFormatException(MESSAGES.errorUtf8InvalidHighSurrogate(Integer.toHexString(uuuuu)));
} // invalidSurrogate(int)
} // class UTF8Reader
Modified: trunk/src/main/java/org/apache/jasper/xmlparser/XMLEncodingDetector.java
===================================================================
--- trunk/src/main/java/org/apache/jasper/xmlparser/XMLEncodingDetector.java 2012-09-14
12:33:07 UTC (rev 2082)
+++ trunk/src/main/java/org/apache/jasper/xmlparser/XMLEncodingDetector.java 2012-09-21
14:14:07 UTC (rev 2083)
@@ -25,6 +25,8 @@
package org.apache.jasper.xmlparser;
+import static org.jboss.web.JasperMessages.MESSAGES;
+
import java.io.EOFException;
import java.io.InputStream;
import java.io.InputStreamReader;
@@ -224,8 +226,7 @@
return new UCSReader(inputStream, UCSReader.UCS4LE);
}
} else {
- err.jspError("jsp.error.xml.encodingByteOrderUnsupported",
- encoding);
+ err.jspError(MESSAGES.unsupportedByteOrderForEncoding(encoding));
}
}
if (ENCODING.equals("ISO-10646-UCS-2")) {
@@ -237,8 +238,7 @@
return new UCSReader(inputStream, UCSReader.UCS2LE);
}
} else {
- err.jspError("jsp.error.xml.encodingByteOrderUnsupported",
- encoding);
+ err.jspError(MESSAGES.unsupportedByteOrderForEncoding(encoding));
}
}
@@ -246,7 +246,7 @@
boolean validIANA = XMLChar.isValidIANAEncoding(encoding);
boolean validJava = XMLChar.isValidJavaEncoding(encoding);
if (!validIANA || (fAllowJavaEncodings && !validJava)) {
- err.jspError("jsp.error.xml.encodingDeclInvalid", encoding);
+ err.jspError(MESSAGES.invalidEncodingDeclared(encoding));
// NOTE: AndyH suggested that, on failure, we use ISO Latin 1
// because every byte is a valid ISO Latin 1 character.
// It may not translate correctly but if we failed on
@@ -264,7 +264,7 @@
if (fAllowJavaEncodings) {
javaEncoding = encoding;
} else {
- err.jspError("jsp.error.xml.encodingDeclInvalid", encoding);
+ err.jspError(MESSAGES.invalidEncodingDeclared(encoding));
// see comment above.
javaEncoding = "ISO8859_1";
}
@@ -1329,10 +1329,11 @@
case STATE_VERSION: {
if (name == fVersionSymbol) {
if (!sawSpace) {
- reportFatalError(scanningTextDecl
- ?
"jsp.error.xml.spaceRequiredBeforeVersionInTextDecl"
- :
"jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl",
- null);
+ if (scanningTextDecl) {
+ MESSAGES.requiredSpaceBeforeVersionInTextDeclaration();
+ } else {
+ MESSAGES.requiredSpaceBeforeVersionInXmlDeclaration();
+ }
}
version = fString.toString();
state = STATE_ENCODING;
@@ -1340,38 +1341,38 @@
// REVISIT: XML REC says we should throw an error
// in such cases.
// some may object the throwing of fatalError.
- err.jspError("jsp.error.xml.versionNotSupported",
- version);
+ err.jspError(MESSAGES.unsupportedXmlVersion(version));
}
} else if (name == fEncodingSymbol) {
if (!scanningTextDecl) {
- err.jspError("jsp.error.xml.versionInfoRequired");
+ err.jspError(MESSAGES.noXmlVersion());
}
if (!sawSpace) {
- reportFatalError(scanningTextDecl
- ?
"jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl"
- :
"jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl",
- null);
+ if (scanningTextDecl) {
+ MESSAGES.requiredSpaceBeforeEncodingInTextDeclaration();
+ } else {
+ MESSAGES.requiredSpaceBeforeEncodingInXmlDeclaration();
+ }
}
encoding = fString.toString();
state = scanningTextDecl ? STATE_DONE : STATE_STANDALONE;
} else {
if (scanningTextDecl) {
-
err.jspError("jsp.error.xml.encodingDeclRequired");
+ err.jspError(MESSAGES.requiredEncodingDeclaration());
+ } else {
+ err.jspError(MESSAGES.requiredVersionDeclaration());
}
- else {
- err.jspError("jsp.error.xml.versionInfoRequired");
- }
}
break;
}
case STATE_ENCODING: {
if (name == fEncodingSymbol) {
if (!sawSpace) {
- reportFatalError(scanningTextDecl
- ?
"jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl"
- :
"jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl",
- null);
+ if (scanningTextDecl) {
+
err.jspError(MESSAGES.requiredSpaceBeforeEncodingInTextDeclaration());
+ } else {
+
err.jspError(MESSAGES.requiredSpaceBeforeEncodingInXmlDeclaration());
+ }
}
encoding = fString.toString();
state = scanningTextDecl ? STATE_DONE : STATE_STANDALONE;
@@ -1379,62 +1380,62 @@
// entity scanner
} else if (!scanningTextDecl && name == fStandaloneSymbol) {
if (!sawSpace) {
-
err.jspError("jsp.error.xml.spaceRequiredBeforeStandalone");
+
err.jspError(MESSAGES.requiredSpaceBeforeStandaloneInXmlDeclaration());
}
standalone = fString.toString();
state = STATE_DONE;
if (!standalone.equals("yes") &&
!standalone.equals("no")) {
- err.jspError("jsp.error.xml.sdDeclInvalid");
+
err.jspError(MESSAGES.invalidStandaloneDeclaration(standalone));
}
} else {
- err.jspError("jsp.error.xml.encodingDeclRequired");
+ err.jspError(MESSAGES.requiredEncodingDeclaration());
}
break;
}
case STATE_STANDALONE: {
if (name == fStandaloneSymbol) {
if (!sawSpace) {
-
err.jspError("jsp.error.xml.spaceRequiredBeforeStandalone");
+
err.jspError(MESSAGES.requiredSpaceBeforeStandaloneInXmlDeclaration());
}
standalone = fString.toString();
state = STATE_DONE;
if (!standalone.equals("yes") &&
!standalone.equals("no")) {
- err.jspError("jsp.error.xml.sdDeclInvalid");
+
err.jspError(MESSAGES.invalidStandaloneDeclaration(standalone));
}
} else {
- err.jspError("jsp.error.xml.encodingDeclRequired");
+ err.jspError(MESSAGES.requiredEncodingDeclaration());
}
break;
}
default: {
- err.jspError("jsp.error.xml.noMorePseudoAttributes");
+ err.jspError(MESSAGES.invalidPseudoAttribute());
}
}
sawSpace = skipSpaces();
}
// REVISIT: should we remove this error reporting?
if (scanningTextDecl && state != STATE_DONE) {
- err.jspError("jsp.error.xml.morePseudoAttributes");
+ err.jspError(MESSAGES.missingPseudoAttribute());
}
// If there is no data in the xml or text decl then we fail to report
// error for version or encoding info above.
if (scanningTextDecl) {
if (!dataFoundForTarget && encoding == null) {
- err.jspError("jsp.error.xml.encodingDeclRequired");
+ err.jspError(MESSAGES.requiredEncodingDeclaration());
}
} else {
if (!dataFoundForTarget && version == null) {
- err.jspError("jsp.error.xml.versionInfoRequired");
+ err.jspError(MESSAGES.requiredVersionDeclaration());
}
}
// end
if (!skipChar('?')) {
- err.jspError("jsp.error.xml.xmlDeclUnterminated");
+ err.jspError(MESSAGES.malformedXmlDeclaration());
}
if (!skipChar('>')) {
- err.jspError("jsp.error.xml.xmlDeclUnterminated");
+ err.jspError(MESSAGES.malformedXmlDeclaration());
}
@@ -1467,22 +1468,24 @@
String name = scanName();
if (name == null) {
- err.jspError("jsp.error.xml.pseudoAttrNameExpected");
+ err.jspError(MESSAGES.missingPseudoAttributeName());
}
skipSpaces();
if (!skipChar('=')) {
- reportFatalError(scanningTextDecl ?
- "jsp.error.xml.eqRequiredInTextDecl"
- : "jsp.error.xml.eqRequiredInXMLDecl",
- name);
+ if (scanningTextDecl) {
+ err.jspError(MESSAGES.missingEqualsInTextDeclaration(name));
+ } else {
+ err.jspError(MESSAGES.missingEqualsInXmlDeclaration(name));
+ }
}
skipSpaces();
int quote = peekChar();
if (quote != '\'' && quote != '"') {
- reportFatalError(scanningTextDecl ?
- "jsp.error.xml.quoteRequiredInTextDecl"
- : "jsp.error.xml.quoteRequiredInXMLDecl" ,
- name);
+ if (scanningTextDecl) {
+ err.jspError(MESSAGES.missingQuoteInTextDeclaration(name));
+ } else {
+ err.jspError(MESSAGES.missingQuoteInXmlDeclaration(name));
+ }
}
scanChar();
int c = scanLiteral(quote, value);
@@ -1498,10 +1501,11 @@
scanSurrogates(fStringBuffer2);
}
else if (XMLChar.isInvalid(c)) {
- String key = scanningTextDecl
- ? "jsp.error.xml.invalidCharInTextDecl"
- : "jsp.error.xml.invalidCharInXMLDecl";
- reportFatalError(key, Integer.toString(c, 16));
+ if (scanningTextDecl) {
+
err.jspError(MESSAGES.invalidCharInTextDeclaration(Integer.toString(c, 16)));
+ } else {
+
err.jspError(MESSAGES.invalidCharInXmlDeclaration(Integer.toString(c, 16)));
+ }
scanChar();
}
}
@@ -1511,10 +1515,11 @@
value.setValues(fStringBuffer2);
}
if (!skipChar(quote)) {
- reportFatalError(scanningTextDecl ?
- "jsp.error.xml.closeQuoteMissingInTextDecl"
- : "jsp.error.xml.closeQuoteMissingInXMLDecl",
- name);
+ if (scanningTextDecl) {
+ err.jspError(MESSAGES.missingClosingQuoteInTextDeclaration(name));
+ } else {
+ err.jspError(MESSAGES.missingClosingQuoteInXmlDeclaration(name));
+ }
}
// return
@@ -1570,8 +1575,7 @@
if (XMLChar.isHighSurrogate(c)) {
scanSurrogates(fStringBuffer);
} else if (XMLChar.isInvalid(c)) {
- err.jspError("jsp.error.xml.invalidCharInPI",
- Integer.toHexString(c));
+
err.jspError(MESSAGES.invalidCharInProcessingInstruction(Integer.toHexString(c)));
scanChar();
}
}
@@ -1598,8 +1602,7 @@
int high = scanChar();
int low = peekChar();
if (!XMLChar.isLowSurrogate(low)) {
- err.jspError("jsp.error.xml.invalidCharInContent",
- Integer.toString(high, 16));
+ err.jspError(MESSAGES.invalidCharInContent(Integer.toString(high, 16)));
return false;
}
scanChar();
@@ -1609,8 +1612,7 @@
// supplemental character must be a valid XML character
if (!XMLChar.isValid(c)) {
- err.jspError("jsp.error.xml.invalidCharInContent",
- Integer.toString(c, 16));
+ err.jspError(MESSAGES.invalidCharInContent(Integer.toString(c, 16)));
return false;
}
@@ -1622,16 +1624,6 @@
}
- // Adapted from:
- // org.apache.xerces.impl.XMLScanner.reportFatalError
- /**
- * Convenience function used in all XML scanners.
- */
- private void reportFatalError(String msgId, String arg)
- throws JasperException {
- err.jspError(msgId, arg);
- }
-
}
Modified: trunk/src/main/java/org/jboss/web/JasperLogger.java
===================================================================
--- trunk/src/main/java/org/jboss/web/JasperLogger.java 2012-09-14 12:33:07 UTC (rev
2082)
+++ trunk/src/main/java/org/jboss/web/JasperLogger.java 2012-09-21 14:14:07 UTC (rev
2083)
@@ -25,6 +25,7 @@
import static org.jboss.logging.Logger.Level.ERROR;
import static org.jboss.logging.Logger.Level.INFO;
import static org.jboss.logging.Logger.Level.WARN;
+import static org.jboss.logging.Logger.Level.DEBUG;
import org.jboss.logging.BasicLogger;
import org.jboss.logging.Cause;
@@ -45,4 +46,122 @@
*/
JasperLogger ROOT_LOGGER = Logger.getMessageLogger(JasperLogger.class,
"org.apache.jasper");
+ /**
+ * A logger with the category of the package name.
+ */
+ JasperLogger COMPILER_LOGGER = Logger.getMessageLogger(JasperLogger.class,
"org.apache.jasper.compiler");
+
+ /**
+ * A logger with the category of the package name.
+ */
+ JasperLogger SERVLET_LOGGER = Logger.getMessageLogger(JasperLogger.class,
"org.apache.jasper.servlet");
+
+ @LogMessage(level = WARN)
+ @Message(id = 5000, value = "Invalid %s value for the initParam keepgenerated.
Will use the default value of \"false\"")
+ void invalidKeepGeneratedValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5001, value = "Invalid %s value for the initParam trimSpaces. Will
use the default value of \"false\"")
+ void invalidTrimSpacesValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5002, value = "Invalid %s value for the initParam enablePooling.
Will use the default value of \"false\"")
+ void invalidEnablePoolingValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5003, value = "Invalid %s value for the initParam mappedfile. Will
use the default value of \"true\"")
+ void invalidMappedFileValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5004, value = "Invalid %s value for the initParam sendErrToClient.
Will use the default value of \"false\"")
+ void invalidSendErrToClientValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5005, value = "Invalid %s value for the initParam classdebuginfo.
Will use the default value of \"true\"")
+ void invalidClassDebugInfoValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5006, value = "Invalid %s value for the initParam checkInterval.
Will disable periodic checking")
+ void invalidCheckIntervalValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5007, value = "Invalid %s value for the initParam
modificationTestInterval. Will use the default value of \"4\" seconds")
+ void invalidModificationTestIntervalValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5008, value = "Invalid %s value for the initParam recompileOnFail.
Will use the default value of \"false\"")
+ void invalidRecompileOnFailValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5009, value = "Invalid %s value for the initParam development.
Will use the default value of \"true\"")
+ void invalidDevelopmentValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5010, value = "Invalid %s value for the initParam suppressSmap.
Will use the default value of \"false\"")
+ void invalidSuppressSmapValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5011, value = "Invalid %s value for the initParam dumpSmap. Will
use the default value of \"false\"")
+ void invalidDumpSmapValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5012, value = "Invalid %s value for the initParam
genStrAsCharArray. Will use the default value of \"false\"")
+ void invalidGenStrAsCharArrayValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5013, value = "Invalid %s value for the initParam
errorOnUseBeanInvalidClassAttribute. Will use the default value of
\"true\"")
+ void invalidErrorOnUseBeanInvalidClassAttributeValue(String value);
+
+ @LogMessage(level = ERROR)
+ @Message(id = 5014, value = "The JSP container needs a work directory")
+ void missingWorkDirectory();
+
+ @LogMessage(level = ERROR)
+ @Message(id = 5015, value = "The JSP container needs a valid work directory
[%s]")
+ void missingWorkDirectory(String workDirectory);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5016, value = "Invalid %s value for the initParam fork. Will use
the default value of \"true\"")
+ void invalidForkValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5017, value = "Invalid %s value for the initParam xpoweredBy. Will
use the default value of \"true\"")
+ void invalidXpoweredByValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5018, value = "Invalid %s value for the initParam
displaySourceFragment. Will use the default value of \"true\"")
+ void invalidDisplaySourceFragmentValue(String value);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5019, value = "Failed loading Java compiler %s")
+ void failedLoadingJavaCompiler(String className, @Cause Throwable t);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5020, value = "Failed loading custom options class %s")
+ void failedLoadingOptions(String className, @Cause Throwable t);
+
+ @LogMessage(level = ERROR)
+ @Message(id = 5021, value = "File \"%s\" not found")
+ void fileNotFound(String uri);
+
+ @LogMessage(level = ERROR)
+ @Message(id = 5022, value = "Error destroying JSP Servlet instance")
+ void errorDestroyingServletInstance(@Cause Throwable t);
+
+ @LogMessage(level = WARN)
+ @Message(id = 5023, value = "Bad value %s in the url-pattern subelement in the
webapp descriptor")
+ void invalidJspPropertyGroupsUrlPattern(String value);
+
+ @LogMessage(level = DEBUG)
+ @Message(id = 5024, value = "Exception closing reader")
+ void errorClosingReader(@Cause Throwable t);
+
+ @LogMessage(level = DEBUG)
+ @Message(id = 5025, value = "Parent class loader is: %s")
+ void logParentClassLoader(String parentClassLoader);
+
+ @LogMessage(level = DEBUG)
+ @Message(id = 5026, value = "Compilation classpath: %s")
+ void logCompilationClasspath(String classpath);
+
}
Modified: trunk/src/main/java/org/jboss/web/JasperMessages.java
===================================================================
--- trunk/src/main/java/org/jboss/web/JasperMessages.java 2012-09-14 12:33:07 UTC (rev
2082)
+++ trunk/src/main/java/org/jboss/web/JasperMessages.java 2012-09-21 14:14:07 UTC (rev
2083)
@@ -22,6 +22,8 @@
package org.jboss.web;
+import java.io.IOException;
+
import org.jboss.logging.Cause;
import org.jboss.logging.Message;
import org.jboss.logging.MessageBundle;
@@ -39,4 +41,634 @@
*/
JasperMessages MESSAGES = Messages.getBundle(JasperMessages.class);
+ @Message(id = 4000, value = "No Java compiler available")
+ IllegalStateException noJavaCompiler();
+
+ @Message(id = 4001, value = "Unable to compile class for JSP")
+ String failedClassCompilation();
+
+ @Message(id = 4002, value = "Unable to load class for JSP")
+ String failedClassLoading();
+
+ @Message(id = 4003, value = "No output folder")
+ IllegalStateException noOutputFolder();
+
+ @Message(id = 4004, value = "No output folder")
+ IllegalStateException badOutputFolderUrl(@Cause Throwable t);
+
+ @Message(id = 4005, value = "Byte '%s' not 7-bit ASCII")
+ IOException invalidByteRead(int b);
+
+ @Message(id = 4006, value = "Mark is not supported by the UTF-8 reader")
+ IOException markNotSupportedInUtf8Reader();
+
+ @Message(id = 4007, value = "Expected byte %s of %s-byte UTF-8 sequence")
+ String errorUtf8ExpectedByte(int position, int count);
+
+ @Message(id = 4008, value = "Invalid byte %s of %s-byte UTF-8 sequence")
+ String errorUtf8InvalidByte(int position, int count);
+
+ @Message(id = 4009, value = "High surrogate bits in UTF-8 sequence must not
exceed 0x10 but found 0x%s")
+ String errorUtf8InvalidHighSurrogate(String data);
+
+ @Message(id = 4010, value = "Given byte order for encoding \"%s\" is
not supported")
+ String unsupportedByteOrderForEncoding(String encoding);
+
+ @Message(id = 4011, value = "Invalid encoding name \"%s\"")
+ String invalidEncodingDeclared(String encoding);
+
+ @Message(id = 4012, value = "XML version \"%s\" is not supported, only
XML 1.0 is supported")
+ String unsupportedXmlVersion(String version);
+
+ @Message(id = 4013, value = "The version is required in the XML
declaration")
+ String noXmlVersion();
+
+ @Message(id = 4014, value = "White space is required before the version pseudo
attribute in the text declaration")
+ String requiredSpaceBeforeVersionInTextDeclaration();
+
+ @Message(id = 4015, value = "White space is required before the version pseudo
attribute in the XML declaration")
+ String requiredSpaceBeforeVersionInXmlDeclaration();
+
+ @Message(id = 4016, value = "White space is required before the encoding pseudo
attribute in the text declaration")
+ String requiredSpaceBeforeEncodingInTextDeclaration();
+
+ @Message(id = 4017, value = "White space is required before the encoding pseudo
attribute in the XML declaration")
+ String requiredSpaceBeforeEncodingInXmlDeclaration();
+
+ @Message(id = 4018, value = "Encoding is required in the text
declaration")
+ String requiredEncodingDeclaration();
+
+ @Message(id = 4019, value = "Version is required in the XML declaration")
+ String requiredVersionDeclaration();
+
+ @Message(id = 4020, value = "White space is required before the standalone
pseudo attribute in the XML declaration")
+ String requiredSpaceBeforeStandaloneInXmlDeclaration();
+
+ @Message(id = 4021, value = "The standalone document declaration value must be
\"yes\" or \"no\", not \"%s\"")
+ String invalidStandaloneDeclaration(String value);
+
+ @Message(id = 4022, value = "No more pseudo attributes is allowed")
+ String invalidPseudoAttribute();
+
+ @Message(id = 4023, value = "More pseudo attributes are expected")
+ String missingPseudoAttribute();
+
+ @Message(id = 4024, value = "The XML declaration must end with
\"?>\"")
+ String malformedXmlDeclaration();
+
+ @Message(id = 4025, value = "A pseudo attribute name is expected")
+ String missingPseudoAttributeName();
+
+ @Message(id = 4026, value = "The '=' character must follow
\"%s\" in the text declaration")
+ String missingEqualsInTextDeclaration(String name);
+
+ @Message(id = 4027, value = "The '=' character must follow
\"%s\" in the XML declaration")
+ String missingEqualsInXmlDeclaration(String name);
+
+ @Message(id = 4028, value = "The value following \"%s\" in the text
declaration must be a quoted string")
+ String missingQuoteInTextDeclaration(String name);
+
+ @Message(id = 4029, value = "The value following \"%s\" in the XML
declaration must be a quoted string")
+ String missingQuoteInXmlDeclaration(String name);
+
+ @Message(id = 4030, value = "An invalid XML character (Unicode: 0x%s) was found
in the text declaration")
+ String invalidCharInTextDeclaration(String name);
+
+ @Message(id = 4031, value = "An invalid XML character (Unicode: 0x%s) was found
in the XML declaration")
+ String invalidCharInXmlDeclaration(String name);
+
+ @Message(id = 4032, value = "Closing quote in the value following
\"%s\" in the text declaration is missing")
+ String missingClosingQuoteInTextDeclaration(String name);
+
+ @Message(id = 4033, value = "Closing quote in the value following
\"%s\" in the XML declaration is missing")
+ String missingClosingQuoteInXmlDeclaration(String name);
+
+ @Message(id = 4034, value = "An invalid XML character (Unicode: 0x%s) was found
in the processing instruction")
+ String invalidCharInProcessingInstruction(String character);
+
+ @Message(id = 4035, value = "An invalid XML character (Unicode: 0x%s) was found
in the element content of the document")
+ String invalidCharInContent(String character);
+
+ @Message(id = 4036, value = "File \"%s\" not found")
+ String fileNotFound(String uri);
+
+ @Message(id = 4037, value = "JSP has been marked unavailable")
+ String unavailable();
+
+ @Message(id = 4038, value = "An exception occurred processing JSP page %s at
line %s\n\n%s\n\nStacktrace:")
+ String jspExceptionWithDetails(String jsp, int line, String extract);
+
+ @Message(id = 4039, value = "Jasper JSP 2.2 Engine")
+ String jspInfo();
+
+ @Message(id = 4040, value = "Null attribute name")
+ NullPointerException nullAttributeName();
+
+ @Message(id = 4041, value = "Cannot set indexed property")
+ String failedSettingBeanIndexedProperty();
+
+ @Message(id = 4042, value = "Cannot find any information on property
'%s' in a bean of type '%s'")
+ String cannotFindBeanProperty(String property, String beanClass);
+
+ @Message(id = 4043, value = "Can't find a method to write property
'%s' of type '%s' in a bean of type '%s'")
+ String cannotSetBeanProperty(String property, String propertyClass, String
beanClass);
+
+ @Message(id = 4044, value = "Attempted a bean operation on a null object")
+ String nullBean();
+
+ @Message(id = 4045, value = "No BeanInfo for the bean of type '%s' could
be found, the class likely does not exist")
+ String cannotFindBeanInfo(String beanClass);
+
+ @Message(id = 4046, value = "Cannot find a method to read property '%s'
in a bean of type '%s'")
+ String cannotGetBeanProperty(String property, String beanClass);
+
+ @Message(id = 4047, value = "Unable to convert string \"%s\" to class
\"%s\" for attribute \"%s\": %s")
+ String errorConvertingBeanProperty(String value, String valueClass, String property,
String errorMessage);
+
+ @Message(id = 4048, value = "Property Editor not registered with the
PropertyEditorManager")
+ IllegalArgumentException noRegisteredPropertyEditor();
+
+ @Message(id = 4049, value = "Illegal to clear() when buffer size == 0")
+ IllegalStateException cannotClearWithNoBuffer();
+
+ @Message(id = 4050, value = "Attempt to clear a buffer that's already been
flushed")
+ IOException cannotClearAfterFlush();
+
+ @Message(id = 4051, value = "JSP Buffer overflow")
+ IOException bufferOverflow();
+
+ @Message(id = 4052, value = "Exception occurred when flushing data")
+ IllegalStateException errorFlushingData(@Cause Throwable t);
+
+ @Message(id = 4053, value = "Attempt to clear a buffer that's already been
flushed")
+ IllegalStateException illegalClearAfterFlush(@Cause Throwable t);
+
+ @Message(id = 4054, value = "Cannot access session scope in page that does not
participate in any session")
+ IllegalStateException cannotUseSessionScope();
+
+ @Message(id = 4055, value = "Invalid scope specified")
+ IllegalArgumentException invalidScope();
+
+ @Message(id = 4056, value = "Attribute value %s is quoted with %s which must be
escaped when used within the value")
+ IllegalArgumentException missingEscaping(String value, String quote);
+
+ @Message(id = 4057, value = "Bad scope specified for useBean")
+ String badScopeForUseBean();
+
+ @Message(id = 4058, value = "Malformed library version number")
+ String malformedLibraryVersionNumber();
+
+ @Message(id = 4059, value = "Default java encoding %s is invalid on your java
platform. An alternate can be specified via the 'javaEncoding' parameter of
JspServlet")
+ String needAlternateEncoding(String encoding);
+
+ @Message(id = 4060, value = "An error occurred at line: %s in the jsp file:
%s")
+ String errorInJspFile(int line, String fileName);
+
+ @Message(id = 4061, value = "An error occurred at line: %s in the generated java
file")
+ String errorInJavaFile(int line);
+
+ @Message(id = 4062, value = "Unable to compile class for JSP: %s")
+ String failedClassCompilation(String errorReport);
+
+ @Message(id = 4063, value = "The value for the useBean class attribute %s is
invalid")
+ String invalidUseBeanAttributeClass(String className);
+
+ @Message(id = 4064, value = "Unable to find setter method for attribute:
%s")
+ String cannotFindSetterMethod(String attributeName);
+
+ @Message(id = 4065, value = "Error introspecting tag handler: %s")
+ String errorIntrospectingTagHandler(String tagHandlerClass);
+
+ @Message(id = 4066, value = "Tag file directory %s does not start with
\"/WEB-INF/tags\"")
+ String invalidTagFileDirectory(String tagFileDirectory);
+
+ @Message(id = 4067, value = "Invalid implicit TLD for tag file at %s")
+ String invalidImplicitTld(String tagFile);
+
+ @Message(id = 4068, value = "Invalid JSP version defined in implicit TLD for tag
file at %s")
+ String invalidImplicitTldVersion(String tagFile);
+
+ @Message(id = 4069, value = "Unable to display JSP extract. Probably due to a
JRE bug (see Tomcat bug 48498 for details).")
+ String errorDisplayingJspExtract();
+
+ @Message(id = 4070, value = "Error reading file \"%s\"")
+ String errorReadingFile(String file);
+
+ @Message(id = 4071, value = "Error parsing file \"%s\"")
+ String errorParsingFile(String file);
+
+ @Message(id = 4072, value = "<jsp:text> must not have any
subelements")
+ String invalidJspTextSubelements();
+
+ @Message(id = 4073, value = "Unterminated %s tag")
+ String unterminatedTag(String tag);
+
+ @Message(id = 4074, value = "According to TLD, tag %s must be empty, but is
not")
+ String invalidEmptyTagSubelements(String tag);
+
+ @Message(id = 4075, value = "Could not add one or more tag libraries: %s")
+ String errorAddingTagLibraries(String errorMessage);
+
+ @Message(id = 4076, value = "Nested <jsp:root>")
+ String nestedJspRoot();
+
+ @Message(id = 4077, value = "%s directive cannot be used in a tag file")
+ String invalidDirectiveInTagFile(String directive);
+
+ @Message(id = 4078, value = "Scripting elements are disallowed here")
+ String invalidScriptingElement();
+
+ @Message(id = 4079, value = "%s action cannot be used in a tag file")
+ String invalidActionInTagFile(String action);
+
+ @Message(id = 4080, value = "Invalid standard action: %s")
+ String invalidStandardAction(String action);
+
+ @Message(id = 4081, value = "No tag \"%s\" defined in tag library
associated with uri \"%s\"")
+ String unknownTag(String tag, String tagLibUri);
+
+ @Message(id = 4082, value = "Unable to load tag handler class \"%s\"
for tag \"%s\"")
+ String errorLoadingTagHandler(String tagClass, String tag);
+
+ @Message(id = 4083, value = "Body of %s element must not contain any XML
elements")
+ String invalidScriptingBody(String element);
+
+ @Message(id = 4084, value = "Unterminated quotes")
+ String unterminatedQuotes();
+
+ @Message(id = 4085, value = "Attribute value should be quoted")
+ String unquotedAttributeValue();
+
+ @Message(id = 4086, value = "Recursive include of file %s")
+ String invalidRecursiveInclude(String file);
+
+ @Message(id = 4087, value = "File %s not seen in include")
+ String invalidInclude(String file);
+
+ @Message(id = 4088, value = "Invalid scope %s specified")
+ String invalidScope(String scope);
+
+ @Message(id = 4089, value = "The attribute %s specified in the standard or
custom action also appears as the value of the name attribute in the enclosed
jsp:attribute")
+ String duplicateAttribute(String attributeName);
+
+ @Message(id = 4090, value = "%s: Mandatory attribute %s missing")
+ String missingMandatoryAttribute(String elementName, String attributeName);
+
+ @Message(id = 4091, value = "%s has invalid attribute: %s")
+ String invalidAttribute(String elementName, String attributeName);
+
+ @Message(id = 4092, value = "Missing \".tag\" suffix in tag file path
%s")
+ String invalidTagFileName(String path);
+
+ @Message(id = 4093, value = "Unsupported encoding: %s")
+ String unsupportedEncoding(String encoding);
+
+ @Message(id = 4094, value = "Page directive: invalid language attribute")
+ String unsupportedPageDirectiveLanguage();
+
+ @Message(id = 4095, value = "Tag directive: invalid language attribute")
+ String unsupportedTagDirectiveLanguage();
+
+ @Message(id = 4096, value = "Page directive: invalid buffer size")
+ String invalidPageDirectiveBufferSize();
+
+ @Message(id = 4097, value = "Page directive: invalid value for session")
+ String invalidPageDirectiveSession();
+
+ @Message(id = 4098, value = "Page directive: invalid value for autoFlush")
+ String invalidPageDirectiveAutoFlush();
+
+ @Message(id = 4099, value = "Page directive: invalid value for
isThreadSafe")
+ String invalidPageDirectiveIsThreadSafe();
+
+ @Message(id = 4100, value = "Page directive: invalid value for
isErrorPage")
+ String invalidPageDirectiveIsErrorPage();
+
+ @Message(id = 4101, value = "Page directive: invalid value for
isELIgnored")
+ String invalidPageDirectiveIsElIgnored();
+
+ @Message(id = 4102, value = "Tag directive: invalid value for
isELIgnored")
+ String invalidTagDirectiveIsElIgnored();
+
+ @Message(id = 4103, value = "Page directive: invalid value for
deferredSyntaxAllowedAsLiteral")
+ String invalidPageDirectiveDeferredSyntaxAllowedAsLiteral();
+
+ @Message(id = 4104, value = "Tag directive: invalid value for
deferredSyntaxAllowedAsLiteral")
+ String invalidTagDirectiveDeferredSyntaxAllowedAsLiteral();
+
+ @Message(id = 4105, value = "Page directive: invalid value for
trimDirectiveWhitespaces")
+ String invalidPageDirectiveTrimDirectiveWhitespaces();
+
+ @Message(id = 4106, value = "Tag directive: invalid value for
trimDirectiveWhitespaces")
+ String invalidTagDirectiveTrimDirectiveWhitespaces();
+
+ @Message(id = 4107, value = "Page-encoding specified in XML prolog (%s) is
different from that specified in jsp-property-group (%s)")
+ String encodingConflict(String prologEncoding, String propertyGroupEncoding);
+
+ @Message(id = 4108, value = "Unable to determine scripting variable name from
attribute %s")
+ String cannotFindVariableNameFromAttribute(String attribute);
+
+ @Message(id = 4109, value = "Name of root element in %s different from
%s")
+ String wrongRootElement(String file, String element);
+
+ @Message(id = 4110, value = "Invalid tag plugin %s")
+ String invalidTagPlugin(String file);
+
+ @Message(id = 4111, value = "Duplicate function name %s in tag library
%s")
+ String duplicateTagLibraryFunctionName(String function, String library);
+
+ @Message(id = 4112, value = "Mandatory TLD element %s missing in %s")
+ String missingRequiredTagLibraryElement(String element, String library);
+
+ @Message(id = 4113, value = "The absolute uri: %s cannot be resolved in either
web.xml or the jar files deployed with this application")
+ String unresolvableAbsoluteUri(String uri);
+
+ @Message(id = 4114, value = "Unable to get JAR resource \"%s\"
containing TLD")
+ String errorAccessingJar(String jar);
+
+ @Message(id = 4115, value = "Missing JAR resource \"%s\" containing
TLD")
+ String missingJar(String jar);
+
+ @Message(id = 4116, value = "Failed to load or instantiate TagExtraInfo class:
%s")
+ String errorLoadingTagExtraInfo(String tei);
+
+ @Message(id = 4117, value = "Failed to load or instantiate TagLibraryValidator
class: %s")
+ String errorLoadingTagLibraryValidator(String tlv);
+
+ @Message(id = 4118, value = "Invalid body-content (%s) in tag directive")
+ String invalidBodyContentInTagDirective(String content);
+
+ @Message(id = 4119, value = "Tag directive: illegal to have multiple occurrences
of the attribute \"%s\" with different values (old: %s, new: %s)")
+ String invalidConflictingTagDirectiveAttributeValues(String attribute, String
oldValue, String newValue);
+
+ @Message(id = 4120, value = "Cannot specify a value type if
'deferredValue' is not 'true'")
+ String cannotUseValueTypeWithoutDeferredValue();
+
+ @Message(id = 4121, value = "Cannot specify a method signature if
'deferredMethod' is not 'true'")
+ String cannotUseMethodSignatureWithoutDeferredMethod();
+
+ @Message(id = 4122, value = "'deferredValue' and
'deferredMethod' cannot be both 'true'")
+ String cannotUseBothDeferredValueAndMethod();
+
+ @Message(id = 4123, value = "Cannot specify both 'fragment' and
'type' attributes. If 'fragment' is present, 'type' is fixed as
'javax.servlet.jsp.tagext.JspFragment'")
+ String cannotUseFragmentWithType();
+
+ @Message(id = 4124, value = "Cannot specify both 'fragment' and
'rtexprvalue' attributes. If 'fragment' is present, 'rtexprvalue'
is fixed as 'true'")
+ String cannotUseFragmentWithRtexprValue();
+
+ @Message(id = 4125, value = "Invalid JSP version defined for tag file at
%s")
+ String invalidTagFileJspVersion(String file);
+
+ @Message(id = 4126, value = "Either name-given or name-from-attribute attribute
must be specified in a variable directive")
+ String mustSpecifyVariableDirectiveEitherName();
+
+ @Message(id = 4127, value = "Cannot specify both name-given or
name-from-attribute attributes in a variable directive")
+ String mustNotSpecifyVariableDirectiveBothName();
+
+ @Message(id = 4128, value = "Both or none of the name-from-attribute and alias
attributes must be specified in a variable directive")
+ String mustNotSpecifyVariableDirectiveBothOrNoneName();
+
+ @Message(id = 4129, value = "The value of %s and the value of %s in line %s are
the same")
+ String invalidDuplicateNames(String name, String name2, int line);
+
+ @Message(id = 4130, value = "Cannot find an attribute directive with a name
attribute with a value \"%s\", the value of this name-from-attribute
attribute.")
+ String cannotFindAttribute(String name);
+
+ @Message(id = 4131, value = "The attribute directive (declared in line %s and
whose name attribute is \"%s\", the value of this name-from-attribute attribute)
must be of type java.lang.String, is \"required\" and not a
\"rtexprvalue\".")
+ String invalidAttributeFound(int line, String name);
+
+ @Message(id = 4132, value = "%s directive can only be used in a tag file")
+ String invalidDirectiveInPage(String directive);
+
+ @Message(id = 4133, value = "Invalid directive")
+ String invalidDirective();
+
+ @Message(id = 4134, value = "The attribute prefix %s does not correspond to any
imported tag library")
+ String invalidAttributePrefix(String prefix);
+
+ @Message(id = 4135, value = "Equal symbol expected")
+ String missingEqual();
+
+ @Message(id = 4136, value = "Quote symbol expected")
+ String missingQuote();
+
+ @Message(id = 4137, value = "Attribute for %s is not properly terminated")
+ String unterminatedAttribute(String end);
+
+ @Message(id = 4138, value = "Unable to include %s")
+ String errorIncluding(String file);
+
+ @Message(id = 4139, value = "The prefix %s specified in this tag directive has
been previously used by an action in file %s line %s")
+ String prefixAlreadyInUse(String prefix, String file, int line);
+
+ @Message(id = 4140, value = "Attempt to redefine the prefix %s to %s, when it
was already defined as %s in the current scope")
+ String prefixRedefinition(String prefix, String uri, String previousUri);
+
+ @Message(id = 4141, value = "Expecting \"jsp:param\" standard action
with \"name\" and \"value\" attributes")
+ String missingParamAction();
+
+ @Message(id = 4142, value = "The %s tag can only have jsp:attribute in its
body")
+ String invalidEmptyBodyTag(String tag);
+
+ @Message(id = 4143, value = "Must use jsp:body to specify tag body for %s if
jsp:attribute is used.")
+ String invalidTagBody(String tag);
+
+ @Message(id = 4144, value = "jsp:attribute must be the subelement of a standard
or custom action")
+ String invalidJspAttribute();
+
+ @Message(id = 4145, value = "jsp:body must be the subelement of a standard or
custom action")
+ String invalidJspBody();
+
+ @Message(id = 4146, value = "jsp:fallback must be a direct child of
jsp:plugin")
+ String invalidJspFallback();
+
+ @Message(id = 4147, value = "jsp:params must be a direct child of
jsp:plugin")
+ String invalidJspParams();
+
+ @Message(id = 4148, value = "The jsp:param action must not be used outside the
jsp:include, jsp:forward, or jsp:params elements")
+ String invalidJspParam();
+
+ @Message(id = 4149, value = "jsp:output must not be used in standard
syntax")
+ String invalidJspOutput();
+
+ @Message(id = 4150, value = "Invalid standard action")
+ String invalidStandardAction();
+
+ @Message(id = 4151, value = "No tag \"%s\" defined in tag library
imported with prefix \"%s\"")
+ String unknownTagPrefix(String tag, String prefix);
+
+ @Message(id = 4152, value = "\'<\', when appears in the body of
<jsp:text>, must be encapsulated within a CDATA")
+ String badContent();
+
+ @Message(id = 4153, value = "%s not allowed in a template text body")
+ String invalidTemplateTextBody(String invalid);
+
+ @Message(id = 4154, value = "Custom tag is not allowed in a template text
body")
+ String invalidTagInTemplateTextBody();
+
+ @Message(id = 4155, value = "The end tag \"</%s\" is
unbalanced")
+ String unbalancedEndTag(String action);
+
+ @Message(id = 4156, value = "A jsp:attribute standard action cannot be nested
within another jsp:attribute standard action")
+ String invalidJspAttributeNesting();
+
+ @Message(id = 4157, value = "A jsp:body standard action cannot be nested within
another jsp:body or jsp:attribute standard action")
+ String invalidJspBodyNesting();
+
+ @Message(id = 4158, value = "Invalid body content type")
+ String invalidBodyContentType();
+
+ @Message(id = 4159, value = "Page directive: illegal to have multiple
occurrences of '%s' with different values (old: %s, new: %s)")
+ String invalidConflictingPageDirectiveAttribute(String attribute, String oldValue,
String newValue);
+
+ @Message(id = 4160, value = "Page directive must not have multiple occurrences
of '%s'")
+ String invalidDuplicatePageDirectiveAttribute(String attribute);
+
+ @Message(id = 4161, value = "Page directive auto flush cannot be used with a
buffer")
+ String invalidConflictingPageDirectiveAutoFlushBuffer();
+
+ @Message(id = 4162, value = "Tag directive must not have multiple occurrences of
'%s'")
+ String invalidDuplicateTagDirectiveAttribute(String attribute);
+
+ @Message(id = 4163, value = "Page-encoding specified in jsp-property-group (%s)
is different from that specified in page directive (%s)")
+ String pageEncodingConflictJspPropertyGroup(String jspPropertyGroupEncoding, String
pageDirectiveEncoding);
+
+ @Message(id = 4164, value = "Page-encoding specified in XML prolog (%s) is
different from that specified in page directive (%s)")
+ String pageEncodingConflictProlog(String prologEncoding, String
pageDirectiveEncoding);
+
+ @Message(id = 4165, value = "Invalid version number: \"%s\", must be
\"1.2\", \"2.0\", \"2.1\", or \"2.2\"")
+ String invalidJspVersionNumber(String version);
+
+ @Message(id = 4166, value = "Neither \'uri\' nor \'tagdir\'
attribute specified")
+ String invalidTaglibDirectiveMissingLocation();
+
+ @Message(id = 4167, value = "Both \'uri\' and \'tagdir\'
attributes specified")
+ String invalidTaglibDirectiveConflictingLocation();
+
+ @Message(id = 4168, value = "jsp:params must contain at least one nested
jsp:param")
+ String invalidEmptyJspParams();
+
+ @Message(id = 4169, value = "setProperty: can't have non-null value when
property=*")
+ String invalidSetProperty();
+
+ @Message(id = 4170, value = "setProperty: can't have non-null value whith
param")
+ String invalidSetPropertyEitherParam();
+
+ @Message(id = 4171, value = "Missing type for useBean")
+ String missingUseBeanType();
+
+ @Message(id = 4172, value = "Duplicate bean name: %s")
+ String duplicateUseBeanName(String name);
+
+ @Message(id = 4173, value = "Illegal for useBean to use session scope when JSP
page declares (via page directive) that it does not participate in sessions")
+ String cannotAccessSessionScopeWithUseBean();
+
+ @Message(id = 4174, value = "Cannot use both and attribute and a type in
useBean")
+ String cannotUseBothAttributeAndTypeInUseBean();
+
+ @Message(id = 4175, value = "Type not declared in plugin")
+ String missingPluginType();
+
+ @Message(id = 4176, value = "Illegal value %s for 'type' attribute in
plugin: must be 'bean' or 'applet'")
+ String badPluginType(String type);
+
+ @Message(id = 4177, value = "Code not declared in plugin")
+ String missingPluginCode();
+
+ @Message(id = 4178, value = "#{..} is not allowed in template text")
+ String invalidDeferredExpressionInTemplateText();
+
+ @Message(id = 4179, value = "TagInfo object for %s is missing from TLD")
+ String missingTagInfo(String tag);
+
+ @Message(id = 4180, value = "The TLD for the class %s specifies an invalid
body-content (JSP) for a SimpleTag")
+ String invalidSimpleTagBodyContent(String tag);
+
+ @Message(id = 4181, value = "The %s tag declares that it accepts dynamic
attributes but does not implement the required interface")
+ String unimplementedDynamicAttributes(String tag);
+
+ @Message(id = 4182, value = "Tag %s has one or more variable subelements and a
TagExtraInfo class that returns one or more VariableInfo")
+ String invalidTeiWithVariableSubelements(String tag);
+
+ @Message(id = 4183, value = "Mandatory attributes missing")
+ String missingMandatoryAttributes();
+
+ @Message(id = 4184, value = "Mandatory XML-style \'name\' attribute
missing")
+ String missingMandatoryNameAttribute();
+
+ @Message(id = 4185, value = "<jsp:output> must not have a
body")
+ String invalidJspOutputBody();
+
+ @Message(id = 4186, value = "<jsp:output>: illegal to have
multiple occurrences of \"%s\" with different values (old: %s, new: %s)")
+ String invalidJspOutputConflict(String attribute, String oldValue, String newValue);
+
+ @Message(id = 4187, value = "<jsp:output>:
'doctype-root-element' and 'doctype-system' attributes must appear
together")
+ String errorJspOutputDoctype();
+
+ @Message(id = 4188, value = "<jsp:output>:
'doctype-system' attribute must appear if 'doctype-public' attribute
appears")
+ String errorJspOutputMissingDoctype();
+
+ @Message(id = 4189, value = "Missing \'var\' or \'varReader\'
attribute")
+ String missingVarAttribute();
+
+ @Message(id = 4190, value = "Only one of \'var\' or
\'varReader\' may be specified")
+ String errorBothVarAttributes();
+
+ @Message(id = 4191, value = "Cannot use both ${} and #{} EL expressions in the
same attribute value")
+ String errorUsingBothElTypes();
+
+ @Message(id = 4192, value = "A literal value was specified for attribute %s that
is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit
literal values in this case")
+ String errorUsingLiteralValueWithDeferredVoidReturnTyep(String attribute);
+
+ @Message(id = 4193, value = "Unknown attribute type (%s) for attribute
%s")
+ String unknownAttributeType(String attribute, String attributeType);
+
+ @Message(id = 4194, value = "Cannot coerce value (%s) to type (%s) for attribute
%s")
+ String errorCoercingAttributeValue(String attribute, String attributeType, String
value);
+
+ @Message(id = 4195, value = "According to TLD or attribute directive in tag
file, attribute %s does not accept any expressions")
+ String noExpressionAllowedForAttribute(String attribute);
+
+ @Message(id = 4196, value = "%s contains invalid expression(s)")
+ String invalidExpression(String attributeValue);
+
+ @Message(id = 4197, value = "Attribute %s invalid for tag %s according to
TLD")
+ String invalidAttributeForTag(String attribute, String tag);
+
+ @Message(id = 4198, value = "The %s attribute of the %s standard action does not
accept any expressions")
+ String noExpressionAllowedForAttributeInAction(String attribute, String action);
+
+ @Message(id = 4199, value = "The function %s must be used with a prefix when a
default namespace is not specified")
+ String missingFunctionPrefix(String function);
+
+ @Message(id = 4200, value = "The function prefix %s does not correspond to any
imported tag library")
+ String unknownFunctionPrefix(String prefix);
+
+ @Message(id = 4201, value = "The function %s cannot be located with the
specified prefix")
+ String unknownFunction(String function);
+
+ @Message(id = 4202, value = "Invalid syntax for function signature in TLD. Tag
Library: %s, Function: %s")
+ String invalidFunctionSignature(String prefix, String function);
+
+ @Message(id = 4203, value = "Invalid syntax for function signature in TLD.
Parenthesis '(' expected. Tag Library: %s, Function: %s")
+ String invalidFunctionSignatureMissingParent(String prefix, String function);
+
+ @Message(id = 4204, value = "The class %s specified in TLD for the function %s
cannot be found")
+ String missingFunctionClass(String className, String function);
+
+ @Message(id = 4205, value = "The class %s specified in the method signature in
TLD for the function %s cannot be found")
+ String missingSignatureClass(String className, String function);
+
+ @Message(id = 4206, value = "Method \"%s\" for function
\"%s\" not found in class \"%s\"")
+ String missingMethodInClass(String method, String function, String className);
+
+ @Message(id = 4207, value = "Validation error messages from TagExtraInfo for
%s")
+ String errorValidatingTag(String tag);
+
+ @Message(id = 4208, value = "Validation error messages from TagLibraryValidator
for %s in %s")
+ String errorValidatingTaglibrary(String taglib, String jsp);
+
+ @Message(id = 4209, value = "An exception occurred processing JSP page %s at
line %s")
+ String jspException(String jsp, int line);
+
}